Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019139 (Isyna1)
Chromosomal location
Chr 8: 73118389 - 73121187 (+)
Description
myo-inositol 1-phosphate synthase A1 Gene [Source:MGI Symbol;Acc:MGI:1919030]
RefSeq_dna
NM_023627 
RefSeq_peptide
NP_076116.1 
MGI
MGI:1919030 
Uniprot/SWISSPROT
Q9JHU9 
Human Ortholog
ENSG00000105655 (ISYNA1)
Omim not available
UniTrap UNI16521
Vector Insertion
Chr 8: 73120811 - 73120895
Public Clones not available
Private Clones OST459203 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019283
Sequence
AGAGCCCTCGGGCCCACGCTGTCCGCTGCCGCAGTCTGATCCAACTCTGGGCCG CTCGCCACGATGGAGCCCGCCGCCGAGATCCTCGTGGATAGCCCG

GACGTGGTCTACAGCCCCGAAACCATCGAGGCGCGCTACGAGTACCGGACAACGCGCGTCAGCCGCGAGGGCGGCGTGCTGCGG GTGCAGCCCAGGGCT

ACGCGTTTCACCTTCCGCACCGCCCGGCAGGTGCCCCGACTCGGGGTCATGTTGGTCGGCTGGGGCGGGAACAACGGCTCCACGCTCACTGCTGCTGTTC

TGGCCAATCGGCTGCGCCTAACCTGGCCCACGCGCACAGGTCGCAAG GAGGCAAACTATTATGGATCGTTGACCCAGGCGGGCACCGTGAACTTGGGTC

TGGATGAGAACGGCCGGGAGGTGTTTGTGCCCTTCAGTGCGCTGCTACCCATGGTGGCCCCCAACGACCTGGTGTTTGATG GCTGGGATATCTCGTCGC

TGAACCTGGCCGAGGCCATGCGGCGCGCGCAGGTCCTGGACTGCGGTCTGCAGGAACAGCTGTGGCCCCACATGGAGAGCCTGCGTCCGCGGCCCTCAGT

CTACATTCCTGAGTTCATCGCTGCCAACCAGACAGCACGTGCGGACAACCTCATCCCTGGCACACGTGCCCAACAG TTGGAGCAAATCCGAAAGGACAT

TAGAGATTTCCGATCCAGTGCGGGATTGGATAAGGTCATCGTGCTGTGGACCGCCAATACGGAGCGCTTCTGCGAGGTGGTCCCAGGTCGCAATGACACA

GCAGAAAACTTGCTACATACTATCCAG CTTGGCCTGGAGGTGTCACCGTCCACACTTTTTGCTGTGGCCAGCATCCTGGAGGACTGCGCCTTCCTCAAT

GGATCCCCACAGAACACACTGGTACCCGGTGCCCTGGAACTGGCTTCGCAGCGCCATGTGTTTGTAGGTGGTGATGACTTCAAGTCAGGGCAGACTAAGG

TCAAGTCTGTCCTGGTGGACTTCCTCATCGGCTCTGGGCTCAAG ACCATGTCCATCGTGAGCTATAACCACCTGGGCAACAACGACGGGCAGAACCTGT

CTGCACCGCTGCAGTTCCGCTCCAAGGAGGTGACAAAGAGCAGTGTGGTGGACGACATGGTTCACAGCAACCATGTGCTCTACGCGCCTGGAGAGCGGCC

AGACCACTGT GTGGTGATCAAATATGTGCCCTATGTTGGCGACAGCAAGCGTGCCTTGGACGAGTACACCTCCGAGCTGATGCTGGGTGGGACAAACAC

CTTGGTGCTCCATAATACCTGCGAG GATTCGCTCCTGGCCGCGCCCATCATGCTGGACCTAGTGCTGCTCACAGAGCTGTGTCAGCGCGTGAGCTTCTG

CACAGACTCGGACCCCGAGCCTCAGGGCTTCCACACAGTGCTGTCCCTGCTTAGCTTCCTGTTTAAGGCCCCGCTTGTGCCCCCGGGCAGCCCTGTAGTG

AATGCCCTCTTCCGCCAGCGCAGCTGTATCGAGAATATTTTCAG - UNI16521 - GGCTTGCGTGGGGCTCCCGCCCCAGAACCACATGCTATTAGA

GCACAAGATGGAGCGTCCAGGCCCAGGCATCAAGCCAGGAGAGGTGGTGGCCACCAGCCCACTGCCTTGCAAGAAAGAGCCCACACCTGCCACCAATGGC

TGCACCGGCGATGCCAATGGGCACCCGCAGGCACCAACACCAAAGCTGTCCACTGCTTAAATCAAGTGACCGGACCGGACCCTTCTACCCCCAATGCCTC

CAACCATAGTACTTCAGCCCTTGCCAAAGACAATAAAGCAAGTCTCAAGC
Translation
 MEPAAEILVDSPDVVYSPETIEARYEYRTTRVSREGGVLR VQPRATRFTFRTARQVPRLGVMLVGWGGNNGSTLTAAVLANRLRLTWPTRTGRK EAN

YYGSLTQAGTVNLGLDENGREVFVPFSALLPMVAPNDLVFDG GWDISSLNLAEAMRRAQVLDCGLQEQLWPHMESLRPRPSVYIPEFIAANQTARADNL

IPGTRAQQ LEQIRKDIRDFRSSAGLDKVIVLWTANTERFCEVVPGRNDTAENLLHTIQ LGLEVSPSTLFAVASILEDCAFLNGSPQNTLVPGALELAS

QRHVFVGGDDFKSGQTKVKSVLVDFLIGSGLK TMSIVSYNHLGNNDGQNLSAPLQFRSKEVTKSSVVDDMVHSNHVLYAPGERPDHC VVIKYVPYVGD

SKRALDEYTSELMLGGTNTLVLHNTCE DSLLAAPIMLDLVLLTELCQRVSFCTDSDPEPQGFHTVLSLLSFLFKAPLVPPGSPVVNALFRQRSCIENIF

R - UNI16521 - RACVGLPPQNHMLLEHKMERPGPGIKPGEVVATSPLPCKKEPTPATNGCTGDANGHPQAPTPKLSTA

For any suggestions or comments, please send an email to unitrap@crg.es