Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019297 (2610027L16Rik)
Chromosomal location
Chr 14: 56364560 - 56374337 (+)
Description
RIKEN cDNA 2610027L16 gene Gene [Source:MGI Symbol;Acc:MGI:1915092]
RefSeq_dna
NM_026403 
RefSeq_peptide
NP_080679.3 
UniGene
Mm.180338 
MGI
MGI:1915092 
Uniprot/SWISSPROT
Q8BMC4 
Uniprot/SPTREMBL
Q3U480 Q3U7B7 
Human Ortholog
ENSG00000196943 (C14orf21)
Omim not available
UniTrap UNI5139
Vector Insertion
Chr 14: 56368280 - 56368828
Public Clones YTC348 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019441
Sequence
GGTTGTGGGAGCTGCAACCGGGAAGCGTGAACGGCTGGTCCCAAAGCACGCATGGGGTTGGGGCCGCGTTCCGCTCACAAAGCGCGACGCCAGTTCTCGG

GTGCCGGCCGGCGGGGACGCGCGGCCCGGGGTTCGGGACGTCCCCCTCCCGGCCGCGATGGTTATCCCCGGCTGCCGGCAGCCGCGCGTGCGGAGCAGGC

CCCCGAGGCTCTCCCGCATCTGAGCCCGGAGGCTCTTGGATATTTCCGACGGGCGCTGTCAGCGCTAAAAGTGGCTCCCGACGCCGCCGAAGAACGAG A

GTTGATGGCGCGCAATATTTTGAAGGAAGTGGAGGCTCAGGCTCTAGCCTTGGCCACGAACAGGACTGGTAGCGAAATGCTGCAGGAGCTTTTGGGGTTC

AGTCCTTTGAAACCCCTGTGTCGAGTGTGGGCCGCTCTGCGCCCCAACTTGCGCTTCGTGGCTTGTCATCGGTGTGGGGTCCACGTATTACAAAGTGCTT

TGCTGCAGCTACCTCGATTGCTGAGGCGTCCTGCGGAGGCAGAGGAGGAGGAGGAGGAAGAGGAGGAGGGTGGTCCCTCGCAAACTCTGGAGGAGCTAGT

CCTGGGACTAGCCGCTGAAGTGTGTGATGATTTTCTGTTCTTCTGTGGAGACACGCATGGCAGCTTCGTGGTCAGAACTCTGCTGCAGGTCTTGGGAGGT

ACTCTTTTGGAGTCCGAGAGAGGCAAGCCCCGTGGCTCCCAGTCGTCTG AAACACAGAGGACTTCAGCTCGGGAATGTAAACCAACTGATTTTGAGGTT

CCTAAAACCTTCTTGAATCGCCTTCAGGACCTGAGCGCCTGCTTTCTGAAGGACATTGCTG - UNI5139 - TATTTATCACCGACAAGATCTCCAGC

TTTTGTCTTCAGGTGGCCTTACAAGTCCTCCACCAAAAATTACCTCAGCACTGTGCCCACCTCTGCGATGCAGTCATTGATTACCTGAGTTCTCGGAATT

CTTCAGCAGATGGCAG CCCTCTACTCCTGTTTCTTCGGGATCAGACGAGCTCTAGACTCTTGGAGCAGGTGCTGCTGGTATTAGAAGCAGAGAGACTCC

AGCGCCTCTATAAGGACCACTTCCAGGGTCAGCTATGCTCCTTGGCTGAGCATCCCATTGCGAACTTCCCTTTGCAGCGCTTGCTGGATGCAATCACTTC

CCCTGAGCTG CTGTCCCTTGTGTTTGAGGAGCTGAGCCCTGCCTTGGAAATGGTGCTGGCCCAGGGCCACCCAGGGGTCGTCGTCGCCCTGGTGGAAGC

CTGCCGCAGGGTTGGGACTCACCAAGCCCAGGTCTTGCAGCTGTTATTTGAG GCATTTCATTGTGCAGAGCCCCCGTCCCGGCAAGCAGCCTGCGTGCC

TCTCTTTGCTGCTTTGTTGGCTTATGAGGTATACTATGAACTAATGGAGGAGGAGGGGGCTGTGCCTGCAGAGCATCAG GTTGAAATGGCCACAGCCAG

AGCGCTGAGGGAGGTGACTGTACTTGGGTCTCTACTGCTCCAGCATTTGCTGTATTTTTCTAATCCTGGACTTGTACTTCGAAGTCTGAGTGCCTTGACC

GGACCACAGCTTCTGACTCTGGCCCAAAGCCCCGCTGGCTCTCATGTATTTGATGCCATCCTGAGTAGCCCCTCAGTGACACACAAGCAGCGTCGTCGTG

TGCTGAAGACCCTAAAG GGACAGTATGTGGCTCTTGCCTGTAGCCGCCATGGCAGCCGTGTATTAGATGCCATCTGGAGTGGAGCAGCTTTGGGGGCTC

GGAAGGAAATTGCTGCTGAATTGG GAGAAAAGAACCAGGAGTTGATTCAAGATCCTTTTGGCCACCATGTGGCTCGAAATGTGGCCCTTACTACCTTCT

TGAAGAGGCGAGAGGCTTGGGAACAACAGCAAAGTACTGTGGCCAAGCGGAGGCGGGCATTGAGCTCTATACTTGAAGACTGAGACTTGCAACGGGACTC

GGTCTTGATGGGGAGGGGAACATGCTTACCCTTCCTGTTTACATTGGATCCAAAAGTCTTACTGCAGCCAGATGTAGTAACATGCACAAAACTGTAAACC

TACTATTCCAGAGGGTAAAACAAGAATATCAAGAATTCAAGGCTAGCCTGCTCTGTGGCAGCTAGATCTTGTTAATCTCTATGTCCATCTGCTATTCTCT

CCCCTCTCCCAAGACATACTGGTAAAGACTTTTGTATTTTTCTTGGAAATATTTTTATTTTATTTTTTAGGGGAAAGTTATCTTGTAGTAAAGCTAGGGA

CAGTGGCCGTTGGTATGCAGGATCTTAGGGGTAGGCGTCAGTAAGAACCTAGATGAAGCAGCGATTACGGTGGGATCAGGATGCAGGGGACAAGGCTGTG

GTTCTGCAGGGTATGTGGAAGGCAGGAGTGGAGGGAAGACAGGTAGCATTCTTCAGGAAGATGTACAGGCCAGAGGAACAAGGCAGTGTGCAGATCTGTT

AGGATGGAGTCAGCTTGGTTACCTAGGGTACACTGCAGACCCCAAGCCTGATGGTGCCTTTACTACCCTCCTGTGTCACATGGAACCAGTCTTTCAGCAC

AGGCTCAAAGCATGATCTCATTAGGAGTGGAGGTGTCTCTGCCCGTGCCACTGCCATCGATCAGCCCCCTCCACCACATGGCGAAGGGTGGAGGAGATGC

CCAGCAGCATATGGCCCAGGCCTTGCAGCAGCGAGGAAGTCCAACGGAGGAGCTCCCTGGAGGGCAGAGTGGAGATCAGAGAGTTAAAGGAAGCTGCAAG

GAGGTCGGGGTTGGATGCTTTGGTGTGGGGGGCTGATAAGGGGGAGTTTATGGGATACATGGATCCGAGGGTTGCATGACAGATTGGTCTCTGACCTGAG

TACTCTTTTAGGGCCAACTCCTTGGAAATCACAGCTCATGGAGTAGAGTCCATAGAATGTAGCTTTCACGTTGAGGCTGCCAAAGAGGTCTCGGGGATTT

TGCTTGTACACATCGAAGGTGATGCGGGCGATGTCCTTGCTGTGTTTTGGCTTCTCCCGTCCTAGGCCGTATGACAACATCCCACTCTGTGGGACATTCT

CATCATTGAAGTGGACCTGCCCTCATACCCTGGGAACCACCACTAATCCTGTCAGTGCCGGATCTGTCTTCCCAATGTCATCTAATGGTTGATGTCCTTC

ACAGCTCCCCAGAGCCTGTGCCCCCACAGGTCAGTGGTAGGCCAGGGAAGAAGCCAGGGAGGACCAGAAAGGAGTGGAGACCTAAGCAGCCCCACTGTGG

GGCTCTCACCTTGGGGCTCCAGCTCTGGCCCTGCTCAAGCACCATCAAGCACGTGTCGTCCTCCAGCAGCTGGAAGAAGTCCTCACTGTCCACAGCAGTC

CCATCCTCCTCCAGGACCAGTGTTAGCACTCCACGTAGCAGCAAGGTCTCCAGGACCTGTCAGTGACAAGAGGCAGGAAGGGAGGCCCCGTCAGCCTCAC

GCTGGTTGGCATATCAGCTCTACCTCCAGGTGTTTTGCCATCTTCCCTGTAGGGGTTTTGTTTGTTTATTTCTTTTTTTGAGACAGGGTGTTGGTGTAGT

GCAGCCTGCTCCCAAACTTAGCAATTCTGTGTTAGTTTGCTGGGTCCTGGGATTGTAGACATGAACACTTCATCTCATCCTTCCT
Translation
MGLGPRSAHKARRQFSGAGRRGRAARGSGRPPPGRDGYPRLPAAARAEQAPEALPHLSPEALGYFRRALSALKVAPDAAEERE ELMARNILKEVEAQAL

ALATNRTGSEMLQELLGFSPLKPLCRVWAALRPNLRFVACHRCGVHVLQSALLQLPRLLRRPAEAEEEEEEEEEGGPSQTLEELVLGLAAEVCDDFLFFC

GDTHGSFVVRTLLQVLGGTLLESERGKPRGSQSSE ETQRTSARECKPTDFEVPKTFLNRLQDLSACFLKDIAV - UNI5139 - VFITDKISSFCLQ

VALQVLHQKLPQHCAHLCDAVIDYLSSRNSSADGS SPLLLFLRDQTSSRLLEQVLLVLEAERLQRLYKDHFQGQLCSLAEHPIANFPLQRLLDAITSPE

L LSLVFEELSPALEMVLAQGHPGVVVALVEACRRVGTHQAQVLQLLFE AFHCAEPPSRQAACVPLFAALLAYEVYYELMEEEGAVPAEHQ VEMATAR

ALREVTVLGSLLLQHLLYFSNPGLVLRSLSALTGPQLLTLAQSPAGSHVFDAILSSPSVTHKQRRRVLKTLK GQYVALACSRHGSRVLDAIWSGAALGA

RKEIAAELG GEKNQELIQDPFGHHVARNVALTTFLKRREAWEQQQSTVAKRRRALSSILED

For any suggestions or comments, please send an email to unitrap@crg.es