Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019320 (Noxo1)
Chromosomal location
Chr 17: 24833179 - 24837472 (+)
Description
NADPH oxidase organizer 1 Gene [Source:MGI (curated);Acc:Noxo1-001]
RefSeq_peptide
NP_082264.2 
UniGene
Mm.390971 
MGI
MGI:1919143 
Uniprot/SWISSPROT
Q8VCM2 
Uniprot/SPTREMBL
Q0VDT6 
Human Ortholog
ENSG00000196408 (NOXO1)
Omim not available
UniTrap UNI34248
Vector Insertion
Chr 17: 24834070 - 24835164
Public Clones IST14238F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019464
Sequence
GAGGCGGCGGCCCGGGTCGCGGAGGCGTAGGAGGCCTCGGGGCGGGAGGAGGCGGCGCCGGAGGCCCAGGCCGAGGCGGCACTGGCGGCTGCGGCTCCGG

CTCTGCGGGTACTCTTGCGCCTGGTGACCCGCCGCGAGCCCGGCGTGCGTGGTCCATGGTGGGGTTCAGGCTTCCTCCGGCAGATGTGAAGTGTGTCGTG

GAAGGCGCGCTGCGGCTGTGCTGAGATCTTGGACTGAGATGAGTTCCGAGATGCTTCTCGCATCACCCCCATCGCTTGGCTCAGACACCTAAGGGCGGCA

AAATTTGGGGTCTTCCTGCCTTACGACGTGCCCACCTACACGCTTCTCGGTGCCTTAGCAACGCGCGACGGGGCGTGGCCTCACAGAGACCAGACAGTAC

TTATTGCCAGAGGCTACCTGTGCCCTAGTAACTGTCCCCCACTGCGCAACCTTGAGAGAGGGCGTGTCCTCATCCTCTAGCTTGGATAAAAGATTATTAT

GCCTATTTTAATAGCAGCCTCAGGAATTTCTTCCTTTTTTTTTTTCTTTTGGAGACAGGGTCTCATGTAACTTGGACTAACTTTGAACTCTGTATGTAGC

TGAGTGAAGATGATGTTGAATTCTTGAATCTTTTTGCCACCACACCACCTCTTCAAGTGTTTGACTTAAACGCCTGTGCCATCACAGGAAGAATTCCTTC

CGCTGCCTCCATGTGTTCATTTACTCTTTCTGCAAATATTTGTAGAGTGGCTGCTCTCTCCAGGTGCTGTTTCCTCCACTGAGCAGAACAAGGAACAAGC

CTCCCTCTTTAGCCTTTAACCAGTGATGCAAATGCGGAAAACCCAGTACACCAGAATCATATTTACAAAACTGATGAAAGCTGTGCAGGGG - UNI342

48 - AACCAGGAAACTGAACTCTTTCCTGGATTGTGAGTGCTTCGAAGGGACTCTACTTAGGGCAGTGTTGGGGAATTCCACTTCACTTCTTCCGGATG

CTCGGAGCTCCTTCAAGCATCCATAGTCATGGCAAGCCCAAGACACCCAGTATCAGCCCATGCTGTAGCCTTGGTGCAAATGGACCGACTCCAG ACATT

TGCCTTCTCCGTGTGCTGGTCAGACAACAGTGACACATTTGTGCGGAGGAGCTGGGATGAGTTCAGGCAGCTCCAG AAGACCCTTAAGAAAACCTTCCC

AGTGGAGGCAGGCCTGCTACGGAGATCTGAACAAGTTCTTCCCAAGCTTCCTG ATGCTCCATTGCTGACACGTCGGGGGCATACTGGTCGAGGACTGGT

ACGTTTGCGGCTGCTGGACACCTATGTACAGGCATTGCTGGCAACCTCAGAACACATATTGAGGAGTTCAGCACTTCACGGCTTCTTTGTACCCAAACCT

CTGGATCTGGAGCCCATGCTGCCTCCTGGCAG CCTGGTGATCCTGCCTACACCAGAGGAGCCCTTATCCCAACCCAGAGGCAGCCTTGACATTCATAGC

CTGGAGGCTCAGAGCATTCCCTGTGTACAGCCTTTCCACACTCTTGACATAAGAGACAGACCTTTCCACACCAAGGCTCAAGAAATTCTGGACATATTAC

TACGACATCCTTCAG GCTGGTGGCTGGTGGAGAACAAGGATCAGCAGGTAGCCTGGTTTCCAGCTCCCTACCTGGAGGAGGTAGCAACGTGCCAAGGCC

AGGAGTCAGGCCTGGCTTTGCAAGGAAGTG GGAGGCAGTTCTGCACTACTCAGGCCTACGAGGGCAGTCGCTCTGATGAGCTATCCGTGCCCTCAGGGG

CACGTGTCCATGTGCTGGAGACCTCAGACCGAGGCTGGTGGCTGTGCAG GTATAATGGCCGGACAGGCCTACTCCCTGCAATGTCGCTGCAACCTGAAG

GGCTGGGCTCGCTCCTGGGCAGGCCAGGGTTCCCAGACAGTGCTGGGGCAGACAAGGTGGCTGAGGACAGGACCATTCCCCCTGTAGTACCAACTCGTCC

CTGTATGAGTGCCATCCAGAGTCGATGCTGCTCCATTACCCGCAGGGCACTGGGACAGGAACAAGGGACTCGGGTTCCCCGTTGAGGATTGTATTGCTGC

TCTGCAGAGAGGTTGTACTGTCAAAGCCAACCTCAGGCAAAGCAGGGATCTAGACCTCACCAAGAAAGCAGGATTAAGAGTGGGGCTCTATGGCTGGCAG

GGCCACGGGCCAGCTAACTTTCTATTTCCTCTAAATAAAACTGGAATGACTTCACCC
Translation
 - UNI34248 - MASPRHPVSAHAVALVQMDRLQ TFAFSVCWSDNSDTFVRRSWDEFRQLQ KTLKKTFPVEAGLLRRSEQVLPKLPD DAPLLTRR

GHTGRGLVRLRLLDTYVQALLATSEHILRSSALHGFFVPKPLDLEPMLPPGS SLVILPTPEEPLSQPRGSLDIHSLEAQSIPCVQPFHTLDIRDRPFHT

KAQEILDILLRHPSG GWWLVENKDQQVAWFPAPYLEEVATCQGQESGLALQGSG GRQFCTTQAYEGSRSDELSVPSGARVHVLETSDRGWWLCR RYN

GRTGLLPAMSLQPEGLGSLLGRPGFPDSAGADKVAEDRTIPPVVPTRPCMSAIQSRCCSITRRALGQEQGTRVPR

For any suggestions or comments, please send an email to unitrap@crg.es