Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019437 (Tlcd1)
Chromosomal location
Chr 11: 77992214 - 77993976 (+)
Description
TLC domain containing 1 Gene [Source:MGI (curated);Acc:Tlcd1-001]
RefSeq_dna
NM_026708 
RefSeq_peptide
NP_080984.1 
UniGene
Mm.390375 
MGI
MGI:1915572 
Uniprot/SWISSPROT
Q99JT6 
Human Ortholog
ENSG00000160606 (TLCD1)
Omim not available
UniTrap UNI35453
Vector Insertion
Chr 11: 77992724 - 77992871
Public Clones IST10228C3 (tigm) IST12860C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27709
Vector Insertion
Chr 11: 77993041 - 77993125
Public Clones not available
Private Clones OST52221 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25170
Vector Insertion
Chr 11: 77993448 - 77993833
Public Clones not available
Private Clones OST193094 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092880
Sequence
GAAGGGGCCTTGAGGGCTCCGCGAAACTGTGGGGCTGGCGGCCCGCGGCAGAAACGATCGTGGCGCGCTGGCCAGAGAAGGAACGGTGTTCCCAGAACTG

TCGGAGGAGACGGCTTAAGGGGCGGACAGACAGACGGCAGGAAGGGTCAGCATGCCCCTACTGTTCCACCCCGCCTGGCCGCTGCTCCTGGGCGCCACGC

TGACCTTCCGGGCACTCCGGCGCGTGCTCTGTCGCCTGCCCCAGCCTGCACACGTGCAAACCGACCCCCTGCGCACCTGGCGTTGGCACAACCTACTCGT

CTCTTTCACCCACTCCATTGTATCAGGGATCTGGGCACTGCTGTG CTTATGGCAAACCCCTGAAATGCTGGTGGAGATTGAAACAGCGTGGTCAGCTTC

TGGCTATTTGCTTGTTTGCTTCTCTGCAG - UNI27709 - GATACTTTATCCACGACACAGTGGACATTGTGGTTAGCAAGCAAACTCGAGCTTCTT

GGGAATACCTTGTTCATCATGTCATG - UNI25170 - - UNI27709 - GCTATGGGCGCCTTCTTCTCTGGTATCTTTTGGAAAAGATTTGTTGG

TGGTGGCGTCTTAACACTACTGGTAGAGGTCAGCAACATCTTCCTCACCTTAAGGATGATGATGAAGATAAACAATGCTCAGGATCTCCTCCTCTACAAG

GTCAACAAGTATATCAACTTGGTCATGTACTTCCTCTTCCGATTGGCCCCTCAGGCCTACCTCACCAAGTTCTTCCTACAGTATGCTGGCCAGAGGACCC

TGGGCACATTCTTGTTGGCCATCCTGCTCATGCTGGACTTGATGATAATCATCTACTTTTCTCGCCTCCTCCGCTCTGATTTCTGCCCTGAACGTGCACC

CAGGCGCCAACAAAAAGACAAATTCTTGACTGAGTGAGAAAGTAGAACCCAGGACTTGTAAAAGGGATGGCAAGCACAGCCAATTGCTCTGTAACATAAA

CTAGTACTCTGCCCCAAGCTTGGGTGTATTCTGGGGCCAGCCTTTCCACCTTAAGCTTACACCCACACTATTGAAAACACT
Translation
MPLLFHPAWPLLLGATLTFRALRRVLCRLPQPAHVQTDPLRTWRWHNLLVSFTHSIVSGIWALLC CLWQTPEMLVEIETAWSASGYLLVCFSAG - UN

I27709 - GYFIHDTVDIVVSKQTRASWEYLVHHVM - UNI25170 - - UNI27709 - AMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMM

MKINNAQDLLLYKVNKYINLVMYFLFRLAPQAYLTKFFLQYAGQRTLGTFLLAILLMLDLMIIIYFSRLLRSDFCPERAPRRQQKDKFLTE
Transcript ENSMUST00000092879
Sequence
GAAGGGGCCTTGAGGGCTCCGCGAAACTGTGGGGCTGGCGGCCCGCGGCAGAAACGATCGTGGCGCGCTGGCCAGAGAAGGAACGGTGTTCCCAGAACTG

TCGGAGGAGACGGCTTAAGGGGCGGACAGACAGACGGCAGGAAGGGTCAGCATGCCCCTACTGTTCCACCCCGCCTGGCCGCTGCTCCTGGGCGCCACGC

TGACCTTCCGGGCACTCCGGCGCGTGCTCTGTCGCCTGCCCCAGCCTGCACACGTGCAAACCGACCCCCTGCGCACCTGGCGTTGGCACAACCTACTCGT

CTCTTTCACCCACTCCATTGTATCAGGGATCTGGGCACTGCTGTG CTTATGGCAAACCCCTGAAATGCTGGTGGAGATTGAAACAGCGTGGTCAGCTTC

TGGCTATTTGCTTGTTTGCTTCTCTGCAG - UNI27709 - GATACTTTATCCACGACACAGTGGACATTGTGGTTAGCAAGCAAACTCGAGCTTCTT

GGGAATACCTTGTTCATCATGTCATG - UNI25170 - - UNI27709 - GCTATGGGCGCCTTCTTCTCTGGTATCTTTTGGAAAAGATTTGTTGG

TGGTGGCGTCTTAACACTACTGGTAGAGGTCAGCAACATCTTCCTCACCTTAAGGATGATGATGAAGATAAACAATGCTCAGGATCTCCTCCTCTACAAG

 - UNI25170 - TATGCTGGCCAGAGGACCCTGGGCACATTCTTGTTGGCCATCCTGCTCATGCTGGACTTGATGATAATCATCTACTTTTCTCGCCT

CCTCCGCTCTGATTTCTGCCCTGAACGTGCACCCAGGCGCCAACAAAAAGACAAATTCTTGACTGAGTGA
Translation
MPLLFHPAWPLLLGATLTFRALRRVLCRLPQPAHVQTDPLRTWRWHNLLVSFTHSIVSGIWALLC CLWQTPEMLVEIETAWSASGYLLVCFSAG - UN

I27709 - GYFIHDTVDIVVSKQTRASWEYLVHHVM - UNI25170 - - UNI27709 - AMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMM

MKINNAQDLLLYK - UNI25170 - YAGQRTLGTFLLAILLMLDLMIIIYFSRLLRSDFCPERAPRRQQKDKFLTE
Transcript ENSMUST00000108338
Sequence
GAAACGATCGTGGCGCGCTGGCCAGAGAAGGAACGGTGTTCCCAGAACTGTCGGAGGAGACGGCTTAAGGGGCGGACAGACAGACGGCAGGAAGGGTCAG

CATGCCCCTACTGTTCCACCCCGCCTGGCCGCTGCTCCTGGGCGCCACGCTGACCTTCCGGGCACTCCGGCGCGTGCTCTGTCGCCTGCCCCAGCCTGCA

CACGTGCAAACCGACCCCCTGCGCACCTGGCGTTGGCACAACCTACTCGTCTCTTTCACCCACTCCATTGTATCAGGGATCTGGGCACTGCTGTG CTTA

TGGCAAACCCCTGAAATGCTGGTGGAGATTGAAACAGCGTGGTCAGCTTCTGGCTATTTGCTTGTTTGCTTCTCTGCAG - UNI27709 - GATACTT

TATCCACGACACAGTGGACATTGTGGTTAGCAAGCAAACTCGAGCTTCTTGGGAATACCTTGTTCATCATGTCATGGTAAGGGAGAACCCGGTGAAATGA

CACAGGCAAAATCTTCACAACCCCTGGAGCCAGGGAGGGAGGCCATCTTAACCCAGCAGCGTCTGACTTCTAAGTTGCCTAAGACTCTCTCAATGTTTAA

ACACCTTCTGGGGACAGCAGAGTGCCTAGGCCTATCTACTATCTAGGTAAACAGACCAGGATGTCATACAGAGTTAGACCCTCGTGGACAAAGTCTAACG

CTAGTGAATAAAGAAACCTTAGCAGTAAA
Translation
MPLLFHPAWPLLLGATLTFRALRRVLCRLPQPAHVQTDPLRTWRWHNLLVSFTHSIVSGIWALLC CLWQTPEMLVEIETAWSASGYLLVCFSAG - UN

I27709 - GYFIHDTVDIVVSKQTRASWEYLVHHVMVRENPVK
Transcript ENSMUST00000098545
Sequence
ATGAGATGGCCGTGGGATCTTTCGCGGGGTGCTCGGACTGGGCTCCCTCTTGCTATTCCCATCACGGGTGAACAGACGCCAAGGATCTCACCTGATTCCG

TTTGGAAAACTACCCAACCAAGAACGGCTGTGGGAAACCCAAG CTTATGGCAAACCCCTGAAATGCTGGTGGAGATTGAAACAGCGTGGTCAGCTTCTG

GCTATTTGCTTGTTTGCTTCTCTGCAG - UNI27709 - GATACTTTATCCACGACACAGTGGACATTGTGGTTAGCAAGCAAACTCGAGCTTCTTGG

GAATACCTTGTTCATCATGTCATG - UNI25170 - - UNI27709 - GCTATGGGCGCCTTCTTCTCTGGTATCTTTTGGAAAAGATTTGTTGGTG

GTGGCGTCTTAACACTACTGGTAGAGGTCAGCAACATCTTCCTCACCTTAAGGATGATGATGAAGATAAACAATGCTCAGGATCTCCTCCTCTACAAGGT

CAACAAGTATATCAACTTGGTCATGTACTTCCTCTTCCGATTGGCCCCTCAGGCCTACCTCACCAAGTTCTTCCTACAGTATGCTGGCCAGAGGACCCTG

GGCACATTCTTGTTGGCCATCCTGCTCATGCTGGACTTGATGATAATCATCTACTTTTCTCGCCTCCTCCGCTCTGATTTCTGCCCTGAACGTGCACCCA

GGCGCCAACAAAAAGACAAATTCTTGACTGAGTGAGAAAGTAGAACCCAGGACTTGTAAAAGGGATGGCAAGCACAGCCAATTGCTCTGTAACATAAACT

AGTACTCTGCCCCAAGCTTGGGTGTATTCTGGGGCCAGCCTTTCCACCTTAAGCTTACACCCACACTATTGAAAACACT
Translation
MRWPWDLSRGARTGLPLAIPITGEQTPRISPDSVWKTTQPRTAVGNPS SLWQTPEMLVEIETAWSASGYLLVCFSAG - UNI27709 - GYFIHDTV

DIVVSKQTRASWEYLVHHVM - UNI25170 - - UNI27709 - AMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMMMKINNAQDLLLYKVNKY

INLVMYFLFRLAPQAYLTKFFLQYAGQRTLGTFLLAILLMLDLMIIIYFSRLLRSDFCPERAPRRQQKDKFLTE

For any suggestions or comments, please send an email to unitrap@crg.es