Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019710 (Mrpl24)
Chromosomal location
Chr 3: 87723428 - 87727594 (+)
Description
mitochondrial ribosomal protein L24 Gene [Source:MGI (curated);Acc:Mrpl24-002]
RefSeq_dna
NM_026591 
RefSeq_peptide
NP_080867.2 
MGI
MGI:1914957 
Uniprot/SWISSPROT
Q9CQ06 
Human Ortholog
ENSG00000143314 (MRPL24)
Omim not available
UniTrap UNI12763
Vector Insertion
Chr 3: 87723427 - 87723628
Public Clones M020A04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29762
Vector Insertion
Chr 3: 87723751 - 87725738
Public Clones E080A06 (ggtc) IST11644G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17335
Vector Insertion
Chr 3: 87725738 - 87725971
Public Clones not available
Private Clones OST444843 (lexicon) OST433655 (lexicon) OST402760 (lexicon) OST379492 (lexicon)
OST311518 (lexicon) OST310954 (lexicon) OST310950 (lexicon) OST309103 (lexicon)
OST245044 (lexicon) OST198763 (lexicon) OST81189 (lexicon) OST72572 (lexicon)
OST68360 (lexicon) OST46210 (lexicon) OST34535 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23299
Vector Insertion
Chr 3: 87725971 - 87726052
Public Clones not available
Private Clones OST266419 (lexicon) OST66402 (lexicon) OST30441 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19295
Vector Insertion
Chr 3: 87726988 - 87727131
Public Clones not available
Private Clones OST395873 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119968
Sequence
GGATTTCCTACGGTTGGCTAAATTTCCTGTTTCCTGTCCATTTTGTAGCAACGGACTAGAGTTCCCAGACGCTGGGAGGCTCGCTTCGGTTTTGTTTTGT

TTTGAGCCTTCCTTTCCGCAATTTGACTACATCTCCCAAAAATCCGGTGGGTGGGGACTGCGGACGTAGAGAACGCACGTGGAAAGAAAGTTGCGGGGAG

GTGAGGCTACTCAGCGACGGGGAAGGTCGGAAGGTGGATAAGCGAAGGGACTTCTTTTCCTAGTTTTAAACTGAGCCTTGGGCTCCTCTTTTGCTAGGAC

GTTGGAGCTATCCGCATATCGGG - UNI17335 - - UNI29762 - CTGGCAAAGTTTTTGAGTGTTTCCCTGGTGAGATTTCTTGAATCTAGCTA

TGCGGCTCTCAGCCCTGCTGGCCTTGGCATCCAAAGCCACTTCCTCCCCCTTCTACCGCTATGGAATGAGCCGTCCAGGTTCCATAGCAGACAAAAGGAA

GAATCCTCCATGGAGCAGGCGGCGCCCAGTAGTGGTAGAGCCCATCTCTGATGAAGACTGGCACCTATTCTGTGGAGACATG - UNI17335 - - UN

I23299 - GTAGAAATCTTAGAAGGCAAGGATGCTGGGAAGCAAGGCAAAGTAGTCCAAGTCGTTCGGCAGCGAAACTGGGTTGTCCTGGAGGGGTTGA

ACACG CATTACCGATACATTGGCAGAACCAAGGACCACCGAGGGACCATGATCGCTAGTGAAGCCCCCTTGCTTCATCACCAGGTCAAGCTAGTGGATC

CTGTGGACAG GAAACCCACTGAGATCCAGTGGAGATTTACTGAGGCAGGAGAACGTGTTCGAGTCTCTACAAGATCTGGCAGAATTATCCCCAAACCTG

AATTTCCTAGAGCAGATGGCATTGTCCCTGAAACATGGACTG - UNI19295 - ATGGCCCCAAGGACACATCAGTGGAAGATGCTCTTGAAAGAACT

TATGTGCCCCGACTAAAGACATTAGAAGAAGATGTGATGGAGGCCATGGGGATCCAGGAGACTCGAAGATTCAAGAAAGTTTATTGGTATTGAGCCTCAG

AGTGCTGCTTCTGCCTGTCCAGTTTTCACCTTGATGGTAGAGGCCTTTTTTCTAAAACACCAATAAAGAGACTTGAGAGCAGCCGTTGTCCACACTACCC

CTCTGCCTCTCCCAAGTGCTTGCATTTTGGGGAGCTCAGGCACAGTGCAGCTTTTCTTCTTGTCAGGATAGACTGGGTAGGTGCTAGCCTTCCCAGGGAT

AGGTCCTGATGTTTGGAGATGGGAGCAAGAAGGCCCCTCTGTTCTTTTCCCTATTTACAGAAATAGGAGTTTTAAGAGTTTTAAGAAATAAAAATTACAT

GGTATTTAT
Translation
 - UNI17335 - - UNI29762 - MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGDM - UNI17335 

- - UNI23299 - VEILEGKDAGKQGKVVQVVRQRNWVVLEGLNT HYRYIGRTKDHRGTMIASEAPLLHHQVKLVDPVDR RKPTEIQWRFTEAGER

VRVSTRSGRIIPKPEFPRADGIVPETWTD - UNI19295 - DGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY
Transcript ENSMUST00000121920
Sequence
AGAGTTCCCAGACGCTGGGAGGCTCGCTTCGGTTTTGTTTTGTTTTGAGCCTTCCTTTCCGCAATTTGACTACATCTCCCAAAAATCCG - UNI12763

 - - UNI17335 - - UNI29762 - CTGGCAAAGTTTTTGAGTGTTTCCCTGGTGAGATTTCTTGAATCTAGCTATGCGGCTCTCAGCCCTGCTGG

CCTTGGCATCCAAAGCCACTTCCTCCCCCTTCTACCGCTATGGAATGAGCCGTCCAGGTTCCATAGCAGACAAAAGGAAGAATCCTCCATGGAGCAGGCG

GCGCCCAGTAGTGGTAGAGCCCATCTCTGATGAAGACTGGCACCTATTCTGTGGAGACATG - UNI17335 - - UNI23299 - GTAGAAATCTTA

GAAGGCAAGGATGCTGGGAAGCAAGGCAAAGTAGTCCAAGTCGTTCGGCAGCGAAACTGGGTTGTCCTGGAGGGGTTGAACACG CATTACCGATACATT

GGCAGAACCAAGGACCACCGAGGGACCATGATCGCTAGTGAAGCCCCCTTGCTTCATCACCAGGTCAAGCTAGTGGATCCTGTGGACAG GAAACCCACT

GAGATCCAGTGGAGATTTACTGAGGCAGGAGAACGTGTTCGAGTCTCTACAAGATCTGGCAGAATTATCCCCAAACCTGAATTTCCTAGAGCAGATGGCA

TTGTCCCTGAAACATGGACTG - UNI19295 - ATGGCCCCAAGGACACATCAGTGGAAGATGCTCTTGAAAGAACTTATGTGCCCCGACTAAAGACA

TTAGAAGAAGATGTGATGGAGGCCATGGGGATCCAGGAGACTCGAAGATTCAAGAAAGTTTATTGGTATTGAGCCTCAGAGTGCTGCTTCTGCCTGTCCA

GTTTTCACCTTGATGGTAGAGGCCTTTTTTCTAAAACACCAATAAAGAGACTTGAGAGCAGCCGTTGTCCACACTACCCCTCTGCCTCTCCCAAGTGCTT

GCATTTTGGGGAGCTCAGGCACAGTGCAGCTTTTCTTCTTGTCAGGATAGACTGGGTAGGTGCTAGCCTTCCCAGGGATAGGTCCTGATGTTTGGAGATG

GGAGCAAGAAGGCCCCTCTGTTCTTTTCCCTATTTACAGAAATAGGAGTTTTAAGAGTTTTAAGAAATAAAAATTACATGGTATTTATAGAAACAGAA
Translation
 - UNI12763 - - UNI17335 - - UNI29762 - MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGD

M - UNI17335 - - UNI23299 - VEILEGKDAGKQGKVVQVVRQRNWVVLEGLNT HYRYIGRTKDHRGTMIASEAPLLHHQVKLVDPVDR RKP

TEIQWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWTD - UNI19295 - DGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYW

Y
Transcript ENSMUST00000121048
Sequence
CTCTCTCTCTTTTTTTTTTTTTCCGAGACTGGGTTTCTTTGTATAGTCCTGGTTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTCGAACTCAGAAA

TCCACCTGCCTCTGCCTCTCAAGTGCTGGGATTAAAGGCGTGCACCACCACTGCCCAGCTAAATGTTCCTTCCTTGTTCAAATCTTCATTCTGTTTTTCT

TGACTCAGCTGGCAAAGTTTTTGAGTGTTTCCCTGGTGAGATTTCTTGAATCTAGCTATGCGGCTCTCAGCCCTGCTGGCCTTGGCATCCAAAGCCACTT

CCTCCCCCTTCTACCGCTATGGAATGAGCCGTCCAGGTTCCATAGCAGACAAAAGGAAGAATCCTCCATGGAGCAGGCGGCGCCCAGTAGTGGTAGAGCC

CATCTCTGATGAAGACTGGCACCTATTCTGTGGAGACATG - UNI17335 - - UNI23299 - GTAGAAATCTTAGAAGGCAAGGATGCTGGGAAG

CAAGGCAAAGTAGTCCAAGTCGTTCGGCAGCGAAACTGGGTTGTCCTGGAGGGGTTGAACACG CATTACCGATACATTGGCAGAACCAAGGACCACCGA

GGGACCATGATCGCTAGTGAAGCCCCCTTGCTTCATCACCAGGTCAAGCTAGTGGATCCTGTGGACAG GAAACCCACTGAGATCCAGTGGAGATTTACT

GAGGCAGGAGAACGTGTTCGAGTCTCTACAAGATCTGGCAGAATTATCCCCAAACCTGAATTTCCTAGAGCAGATGGCATTGTCCCTGAAACATGGACTG

 - UNI19295 - ATGGCCCCAAGGACACATCAGTGGAAGATGCTCTTGAAAGAACTTATGTGCCCCGACTAAAGACATTAGAAGAAGATGTGATGGAG

GCCATGGGGATCCAGGAGACTCGAAGATTCAAGAAAGTTTATTGGTATTGAGCCTCAGAGTGCTGCTTCTGCCTGTCCAGTTTTCACCTTGATGGTAGAG

GCCTTTTTTCTAAAACACCAATAAAGAGACTTGAGAGCAGCCGTTGTCCACACTACCCCTCTGCCTCTCCCAAGTGCTTGCATTTTGGGGAGCTCAGGCA

CAGTGCAGCTTTTCTTCTTGTCAGGATAGACTGGGTAGGTGCTAGCCTTCCCAGGGATAGGTCCTGATGTTTGGAGATGGGAGCAAGAAGGCCCCTCTGT

TCTTTTCCCTATTTACAGAAATAGGAGTTTTAAGAGTTTTAAGAAATAAAAATTACATGGTATTTATAGAAACAGAA
Translation
MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGDM - UNI17335 - - UNI23299 - VEILEGKDAGKQ

GKVVQVVRQRNWVVLEGLNT HYRYIGRTKDHRGTMIASEAPLLHHQVKLVDPVDR RKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETW

TD - UNI19295 - DGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY
Transcript ENSMUST00000019854
Sequence
CATTTTGTAGCAACGGACTAGAGTTCCCAGACGCTGGGAGGCTCGCTTCGGTTTTGTTTTGTTTTGAGCCTTCCTTTCCGCAATTTGACTACATCTCCCA

AAAATCCGGTGGGTGGGGACTGCGGACGTAGAGAACGCACGTGGAAAGAAAGTTGCGGGGAG - UNI12763 - - UNI17335 - - UNI29762 

- CTGGCAAAGTTTTTGAGTGTTTCCCTGGTGAGATTTCTTGAATCTAGCTATGCGGCTCTCAGCCCTGCTGGCCTTGGCATCCAAAGCCACTTCCTCCC

CCTTCTACCGCTATGGAATGAGCCGTCCAGGTTCCATAGCAGACAAAAGGAAGAATCCTCCATGGAGCAGGCGGCGCCCAGTAGTGGTAGAGCCCATCTC

TGATGAAGACTGGCACCTATTCTGTGGAGACATG - UNI17335 - - UNI23299 - GTAGAAATCTTAGAAGGCAAGGATGCTGGGAAGCAAGGC

AAAGTAGTCCAAGTCGTTCGGCAGCGAAACTGGGTTGTCCTGGAGGGGTTGAACACG CATTACCGATACATTGGCAGAACCAAGGACCACCGAGGGACC

ATGATCGCTAGTGAAGCCCCCTTGCTTCATCACCAGGTCAAGCTAGTGGATCCTGTGGACAG GAAACCCACTGAGATCCAGTGGAGATTTACTGAGGCA

GGAGAACGTGTTCGAGTCTCTACAAGATCTGGCAGAATTATCCCCAAACCTGAATTTCCTAGAGCAGATGGCATTGTCCCTGAAACATGGACTG - UNI

19295 - ATGGCCCCAAGGACACATCAGTGGAAGATGCTCTTGAAAGAACTTATGTGCCCCGACTAAAGACATTAGAAGAAGATGTGATGGAGGCCATG

GGGATCCAGGAGACTCGAAGATTCAAGAAAGTTTATTGGTATTGAGCCTCAGAGTGCTGCTTCTGCCTGTCCAGTTTTCACCTTGATGGTAGAGGCCTTT

TTTCTAAAACACCAATAAAGAGACTTGAGAGC
Translation
 - UNI12763 - - UNI17335 - - UNI29762 - MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGD

M - UNI17335 - - UNI23299 - VEILEGKDAGKQGKVVQVVRQRNWVVLEGLNT HYRYIGRTKDHRGTMIASEAPLLHHQVKLVDPVDR RKP

TEIQWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWTD - UNI19295 - DGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYW

Y

For any suggestions or comments, please send an email to unitrap@crg.es