Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019718 (2810055F11Rik)
Chromosomal location
Chr 12: 73174480 - 73186426 (-)
Description
RIKEN cDNA 2810055F11 gene Gene [Source:MGI Symbol;Acc:MGI:1914467]
RefSeq_dna
NM_026038 
RefSeq_peptide
NP_080314.1 
MGI
MGI:1914467 
Uniprot/SWISSPROT
Q9CXA2 
Human Ortholog
ENSG00000126790 (C14orf149)
Omim not available
UniTrap UNI30715
Vector Insertion
Chr 12: 73180473 - 73186427
Public Clones CMHD-GT_534H2-5S (cmhd) IST10381D3 (tigm) IST10126C3BBR1 (tigm) IST12211E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019862
Sequence
CTCTGGAGCCACGCCCCCATTTGGGGGGTCTAGTTTTCTAATCCCTGCCCACGCTCCCTGTCCTGTCGCCCAGGCTCGCCCCTGTTGGGAGTCTAACTCT

GAATCCTGCTAGCTCGGGCGCGCCCAGTCTAAGATTCCGGACGCTGGTCGCTGGGTGATCTCTGCTCGCCGGCTTGGCCCTGAGATTGCCACCGGTTCTG

CGCGTTCTCCCGTTGGGTTTGGCGCTTTCTCCCTGCTTGGAGAGAGCACCACCGCGCTGTGCGGCAGTCCCTGGACGCAGACAATGGAGGCGGCGCTGGC

AGTGACCCGGCTGCCCCCAAACGACCCGAGGACGCCAGCACTGTCGGTGGTGGACATGCACACAGGCGGCGAGCCTCTGCGCATCGTGCACGCCGGGTGT

CCGGAGGTGGCAGGGCCCACGTTGCTGGCCAAGCGTCGCTACATGCGTCAACACCTCGACTACATCCGGCGGCGGCTCGTGTTCGAGCCCCGCGGCCACC

GGGACATGTACGGGGCCATCCTGGTGCCCAGTGAGCTGCCAGACGCACACCTAGGCGTCCTGTTCTTGCACAACGAAGGCTACAGCTCCATGTGCGGTCA

CGCGGTGCTAGCGCTGGGCCGCTTCGCGCTCGACTTTGGACTGGTGCCCGCTCCCCCAAAAGGCGCCCGGGAGGCTCAGGTCAACATCCACTGCCCGTGT

GGTCTGGTGACCGCCTTCGTAGAGTGTGAAGGTGGCCGCAGTTGCGGCCCTGTGCGCTTCCACAGCGTCCCAGCCTTTGTCCTGGCCTCAG - UNI307

15 - ACCTCACAGTGGATGTTCCTGGCCATGGAAAGGTGCTGGTGGACATTGCATATGGTGGGGCATTTTATGCGTTTGTTAGTGCAGAAAAATTAGGA

CTTGATGTGTGTTCTGCGAAGACGAGGGACCTTGTGGATGCGGCAAGTGCATTGACAGGAGCAGTGAAAGCACAG - UNI30715 - TTTAAAATCAA

CCATCCTGAGAGTGAAGACCTTGGTTTTTTGTATGGATCCATCTTGACGGATGGAAAAGATGCTTATAGTGAGGAGGCCACCACCAACATCTGCGTGTTT

GCCGATGAACAG GTTGACAGAAGCCCCACCGGCTCGGGAGTGACAGCCAGAATTGCTCTGCAGTATCATAAGGGGCTCCTGCAGCTGAACCAGACCAGA

GCCTTCAAAAGCAGCGCAACTGGCTCGGTGTTCACAGGCTGTGCCGTGAGG GAAGCAAAGTGTGGAGATTTCAAAGCTGTCATAGTGGAAGTTGCAGGA

CAAGCCCATTACACAGGGACAGCAAACTTGACAGTGGAAGATGGTGACCCACTAAGGGATGGCTTTCTTCTCAAGTGACTTTTTTTTTTCATAAGTTTTA

AAGGTTTTGCTTAGAAAGTAATTACCTTTAAATTGTGTTTTCTCTGTATTATGTGCAAACCAGTATCCAGTTACACTTACAGGCTAATTTTTATACTTTC

TAAAAAGTATGTTTAGTATACTGAGTCTAAATGTAAGGTATTATACTTCCTATTTGTCAACCTTTTGAGCATAAATGTCGCTAATGGGGCAAACAGAGTG

CCAAGAATCCGGAAACTTTTAAAGCATTAGTATACAAGGCAAAATTAAAGCACAGTTACTTAATCTATGCTATGGAAATGATAATACTTGTAAGTTTTTT

TTGATTGCTAGCTTCAGCTATAAACCACACAATAGTAAATGTTGTGAGTTTGTTATTTTAATGTTCCAGTTTGAGTAAAATAAAGGCATCTGTAAG
Translation
MEAALAVTRLPPNDPRTPALSVVDMHTGGEPLRIVHAGCPEVAGPTLLAKRRYMRQHLDYIRRRLVFEPRGHRDMYGAILVPSELPDAHLGVLFLHNEGY

SSMCGHAVLALGRFALDFGLVPAPPKGAREAQVNIHCPCGLVTAFVECEGGRSCGPVRFHSVPAFVLASD - UNI30715 - DLTVDVPGHGKVLVDI

AYGGAFYAFVSAEKLGLDVCSAKTRDLVDAASALTGAVKAQ - UNI30715 - FKINHPESEDLGFLYGSILTDGKDAYSEEATTNICVFADEQ VDR

SPTGSGVTARIALQYHKGLLQLNQTRAFKSSATGSVFTGCAVR EAKCGDFKAVIVEVAGQAHYTGTANLTVEDGDPLRDGFLLK

For any suggestions or comments, please send an email to unitrap@crg.es