Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019732 (Calr3)
Chromosomal location
Chr 8: 74948082 - 74967677 (-)
Description
calreticulin 3 Gene [Source:MGI (curated);Acc:Calr3-001]
RefSeq_dna
NM_029782 NM_028500 
RefSeq_peptide
NP_084058.2 NP_082776.1 
UniGene
Mm.196315 
MGI
MGI:1920566 
Uniprot/SWISSPROT
Q9D9Q6 
Uniprot/SPTREMBL
Q9D373 Q8BL82 B1Q2L7 
Human Ortholog
ENSG00000141979 (CALR3)
Omim not available
UniTrap UNI23034
Vector Insertion
Chr 8: 74962535 - 74967293
Public Clones IST14131G3 (tigm)
Private Clones OST278474 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34573
Vector Insertion
Chr 8: 74958862 - 74962535
Public Clones IST13115C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24710
Vector Insertion
Chr 8: 74958784 - 74958862
Public Clones not available
Private Clones OST209248 (lexicon) OST76934 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109973
Sequence
GCTCTGTTGTGGGAGTCTGACACGATGTCCTGTTGGCCTTGTTTTCTTATTTGTGCTGATTCATAGTTGAGTGCAAGGTGACTTTAGCAGGAGGGAGCCA

GCCATCAGAGCTTTGCTTCAATGTCTTCTGGTGAACTCAAGAGCACCCCAGACAGATCAAGTTACTGTTCCCTTGGTGGGGCAGGATGCTTAG - UNI2

4710 - - UNI34573 - GACCTGATATTTGTGGATTTGATATCAAGAAAGTTCATGTTATCTTATATTTCAAGAATCAATATCATGAAAACAAGAAG

CCAATCAGATGCAAG GTGGATGGCTTCACGCATCTCTACACCCTGATCTTAAGACCAGATCTTTCTTACGAGGTAAAAGTCGATGGCCAGTCCATTGAG

TCTGGCAGCATTGAGTATGACTGGAACCTGACATCGCTGAGGAAAACGGAAAAGACATCACTGGACTCTAGGGACTGGGATCAGGTGGAAGGCAGTAAAG

TCCAG GATTGGGAA AGCACTTTCTGGATGCGGGTGCCAGCAAGCCGAGTGACTGGAACA
Translation
MSSGELKSTPDRSSYCSLGGAGCLG - UNI24710 - - UNI34573 - GPDICGFDIKKVHVILYFKNQYHENKKPIRCK VDGFTHLYTLILRPD

LSYEVKVDGQSIESGSIEYDWNLTSLRKTEKTSLDSRDWDQVEGSKVQ DWE STFWMRVPASRVTGT
Transcript ENSMUST00000109974
Sequence
GCTCTGTTGTGGGAGTCTGACACGATGTCCTGTTGGCCTTGTTTTCTTATTTGTGCTGATTCATAGTTGAGTGCAAGGTGACTTTAGCAGGAGGGAGCCA

GCCATCAGAGCTTTGCTTCAATGTCTTCTGGTGAACTCAAGAGCACCCCAGACAGATCAAGTTACTGTTCCCTTGGTGGGGCAGGATGCTTAG - UNI2

4710 - - UNI34573 - GACCTGATATTTGTGGATTTGATATCAAGAAAGTTCATGTTATCTTATATTTCAAGAATCAATATCATGAAAACAAGAAG

CCAATCAGATGCAAG GTGGATGGCTTCACGCATCTCTACACCCTGATCTTAAGACCAGATCTTTCTTACGAGGTAAAAGTCGATGGCCAGTCCATTGAG

TCTGGCAGCATTGAGTATGACTGGAACCTGACATCGCTGAGGAAAACGGAAAAGACATCACTGGACTCTAGGGACTGGGATCAGGTGGAAGGCAGTAAAG

TCCAG GATTGGGAAAAGCACTTTCTGGATGCGGGTGCCAGCAAGCCGAGTGACTGGAACAGTGAGCTGGATGGGGACTGGCTGCAGAAGCCACCATATG

AG GATGGCCTGAAAGCTGAGGGCATCGACAAGGACGTGTGGCTCCACCAGAAGATGAGACCTGCTGGCTACCTGACGCAGTATGACCTCTCAGAGTTTG

AGAACATTGGCGCCATTGGTCTAGAGCTGTGGCAG GTGAGATCTGGAACCATCTTTGATAACTTCCTGATCACAGATGATGAAGAATATGCAGAGAAGT

TTGGCAAGGCCACCTGGGGAGAAACTAAG GGTCCAGAAAAGGAGATGGATGCCATACAGGCCAAGGAAGAAGTGAAAAAGGCCCGTGAAGAAGATGAGG

AGGATCTGCTGATGGGGAAGTTTCACAGGCACAACCATTTCAGCAGATTCCACAGGCAGGGCGAACTATAGTCATCCTCACTCTGCATGCTGAGTGGCCC

AGCTGCAACTCTAATAATACACATTTGAATGATCACATCTACATGGTCATTTGTCCAGTTTCTGAAAAACAATCCCCTGTTTGTGTTAGGGTCCCCCATT

TCTTCTATAGACCCCTATGACCCCAGGGTCTGCAATAAGTTTCTGTTGACGGCATGTGGTGGCACACTCCTTTAATCTCAGGACTTGAGAGGCAGAAGCA

GACAGATCTGGGATTTCCACATCAGCCTGGTCCATGTAGTGAGTTCTAGGACAGCCTGGGACACATAGTGAGACACTGTTTAAATTTTTTTCCCTGCATA

GAACAGATCATTGAAAGCCAGAGACCTATAAGAATCTGGCCATAAACAATGTGCTTTTTTTTTTTTTTGAAACTCTTAAATATTTTCATGAATAAAAGAT

GAT
Translation
MSSGELKSTPDRSSYCSLGGAGCLG - UNI24710 - - UNI34573 - GPDICGFDIKKVHVILYFKNQYHENKKPIRCK VDGFTHLYTLILRPD

LSYEVKVDGQSIESGSIEYDWNLTSLRKTEKTSLDSRDWDQVEGSKVQ DWEKHFLDAGASKPSDWNSELDGDWLQKPPYE DGLKAEGIDKDVWLHQKM

RPAGYLTQYDLSEFENIGAIGLELWQ VRSGTIFDNFLITDDEEYAEKFGKATWGETK GPEKEMDAIQAKEEVKKAREEDEEDLLMGKFHRHNHFSRFH

RQGEL
Transcript ENSMUST00000019876
Sequence
AATCCCAAGGCATGCCGGGAGTTGTAGTTTCTGAGTTGCGCCCGTCAAGCGGTACGGACGCCTGAGAGCAGAGAGTTGAAGTCGCACGTGCAGCTATGGT

CTCGGCTCGTGCATTGCTCTGGGCCATCTGTGTGCTGCGCGTGGCACTAGCCACTGTGTACTTCCAGGAGGAGTTTCTAGACGGAG AGCGCTGGAGGAA

CCGCTGGGTGCAGTCCACCAATGACTCCCAGTTTGGGCACTTCAGAGTCTCATCGGGGAAGTTCTATGGGCATAAAGAGAAAGACAAAG - UNI23034

 - - UNI34573 - GCCTGCAGACTACCCAAAACAGCCGATTCTATGCCATCTCTGCGAGCTTCAAGCCATTCAGCAACAAAGGGAAGACCCTGGTAA

TCCAGTACACGGTGAAGCATGAGCAGAAGATGGACTGTGGTGGTGGTTACATCAAGGTGTTTCCGTCTGACCTGGACCAGAAGAAGATGAACGGAAAATC

TCAGTACTACATCATGTTTG - UNI24710 - - UNI34573 - GACCTGATATTTGTGGATTTGATATCAAGAAAGTTCATGTTATCTTATATTTC

AAGAATCAATATCATGAAAACAAGAAGCCAATCAGATGCAAG GTGGATGGCTTCACGCATCTCTACACCCTGATCTTAAGACCAGATCTTTCTTACGAG

GTAAAAGTCGATGGCCAGTCCATTGAGTCTGGCAGCATTGAGTATGACTGGAACCTGACATCGCTGAGGAAAACGGAAAAGACATCACTGGACTCTAGGG

ACTGGGATCAGGTGGAAGGCAGTAAAGTCCAG GATTGGGAAAAGCACTTTCTGGATGCGGGTGCCAGCAAGCCGAGTGACTGGAACAGTGAGCTGGATG

GGGACTGGCTGCAGAAGCCACCATATGAG GATGGCCTGAAAGCTGAGGGCATCGACAAGGACGTGTGGCTCCACCAGAAGATGAGACCTGCTGGCTACC

TGACGCAGTATGACCTCTCAGAGTTTGAGAACATTGGCGCCATTGGTCTAGAGCTGTGGCAG GTGAGATCTGGAACCATCTTTGATAACTTCCTGATCA

CAGATGATGAAGAATATGCAGAGAAGTTTGGCAAGGCCACCTGGGGAGAAACTAAG GGTCCAGAAAAGGAGATGGATGCCATACAGGCCAAGGAAGAAG

TGAAAAAGGCCCGTGAAGAAGATGAGGAGGATCTGCTGATGGGGAAGTTTCACAGGCACAACCATTTCAGCAGATTCCACAGGCAGGGCGAACTATAGTC

ATCCTCACTCTGCATGCTGAGTGGCCCAGCTGCAACTCTAATAATACACATTTGAATGATC
Translation
MVSARALLWAICVLRVALATVYFQEEFLDGE ERWRNRWVQSTNDSQFGHFRVSSGKFYGHKEKDKG - UNI23034 - - UNI34573 - GLQTTQ

NSRFYAISASFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPSDLDQKKMNGKSQYYIMFG - UNI24710 - - UNI34573 - GPDICGFDIK

KVHVILYFKNQYHENKKPIRCK VDGFTHLYTLILRPDLSYEVKVDGQSIESGSIEYDWNLTSLRKTEKTSLDSRDWDQVEGSKVQ DWEKHFLDAGASK

PSDWNSELDGDWLQKPPYE DGLKAEGIDKDVWLHQKMRPAGYLTQYDLSEFENIGAIGLELWQ VRSGTIFDNFLITDDEEYAEKFGKATWGETK GPE

KEMDAIQAKEEVKKAREEDEEDLLMGKFHRHNHFSRFHRQGEL

For any suggestions or comments, please send an email to unitrap@crg.es