Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019734 (Tmc4)
Chromosomal location
Chr 7: 3617393 - 3629080 (-)
Description
transmembrane channel-like gene family 4 Gene [Source:MGI (curated);Acc:Tmc4-001]
RefSeq_dna
NM_181820 
RefSeq_peptide
NP_861541.2 
UniGene
Mm.360398 
MGI
MGI:2669035 
Uniprot/SWISSPROT
Q7TQ65 
Human Ortholog
ENSG00000167608 (TMC4)
Omim not available
UniTrap UNI34232
Vector Insertion
Chr 7: 3623564 - 3626311
Public Clones IST14619B2 (tigm) IST11433C6 (tigm) IST12500F1 (tigm) IST11942F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28533
Vector Insertion
Chr 7: 3617611 - 3617703
Public Clones not available
Private Clones OST28719 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121743
Sequence
TTTCAATCCTTTGTGTTCATCCCAGGCCCATCGCTGGCGTCTGTGCTGAACGATCTCCCCAGCGCTGCTACGCTGCGATACCGCGGCCCTGGTGTGCTCC

CTTGGGGAACACTGGATGAAGATGATGATGAAGGAGGAAGGAGCCTTCAGGCCTTTGCAGAAACTGCACAAATGGAATCTCACCCTTCCCGGGAACTTCC

CTGGCCTATGCAGGCAAGGCGGGCACACAG GAAGAGCCAGGCTACAGGGCAGCTGGCTTCTGGCTCTGAATCCAGGGCTGCCTACTGGACCCGACAGCT

TTCCCGGACCAAGGGAAAAATGAAAGAAGGCTTTCAAACTATACAGCCCTGGGCATGGACGCTGAAGAAAATTGGGG GTCAGTTTGGAGCAGGCACTGA

GTCCTACTTCTCCCTGCTGCGCTTCCTGCTCTTTCTCAACCTGGTGGCATCTGTCATTGAAATCTGCATGAAGCTGATCCCCACCTGGCTGGAAGGGGCT

CCTCCAGGTCCCCCTGGCCCTAACATCTCTTCACCCTGTGGTTCCTATATTCCACACACTCATGGCCTGGTCGCCTTCCCCACCCAGCTTTTCAACTTGC

TCTCTGGAGAG - UNI34232 - GGTTACCTTGAGTGGTCCCCTCTATTCTATGGGTTCTACCCACCCCGATCGAACCTGGCCATCACCTACCTGTGC

TCCGTCTTTGCCATCAGCATCATCTACTTGCTGTGCATCCTACGACG - UNI34232 - TTCGGTGTCCGGGTTGAAGGAGACACTGTTGGCGGAGTC

AGACATTCTGACCAGCTACAGTCACCGAGTGTTCTCAGCTTGGAATTTTGGCCTCTGCGGGGACGTGCACGTGCGGCTGCGCCAGCGCATCATTTTGTAT

GAACTACAG - UNI34232 - GTGGACCTAGAGGAAGCAGTAGTCCGGCGCCGTGCTGCGGAGCAGACTCTGAGCCAACGAGCCAAGGTGTGGTCGAT

GAGGGCGCTGCTCAACGTGCTGGTCCTCGCGCTGCTCGGGGCGGCCTTCTATGGCATCTACTGGGCCACCGAGTACACCTTGACACTACAG GAGACGCC

CCTTGTCCGACAGACCCCACTATTCAAGCTTCTGGTGGATTATCTACCATCCATCTTCATTTCTCTGTTCAACTTTGTGCTGCCTCCTGTGTTCAAGTTC

ATTGCCTCACTAGAGGGCTACACTCAAAGCCGACAGATCGTCTTGATCCTGCTTAG GACTGTGTTTTTGCGTCTGGCCTCGCTGGTGTTCCTTCTGGTC

TCTCTGTGGAGTCAGATCACGTGTGGGGGAAACATGGAGGCAGAAGGATGCAAGGCCTGCGGCTATAATTACAAAGAAATTCCG TGCTGGGAGACTCGG

CTGGGCCAGGAGATGTACAAACTTGTACTCTTTGATCTGCTGATGGGCCTGTTGGTCACGCTGTTGGTCCAGTTTCCTAGGAA GATACTCTGTGGCCTC

TGTCCTGGGGCACTGGGTCGTCTGTCGGGAACCCTGGAGTTCCAGGTGCCAGATGAGGTGCTGGGGCTCATCTATGCGCAGACCGTGGTCTGGGTGGGAA

GCTTCTTCTGCCCTTTACTGCCTTTGATCAACACTGCTAAGTTCCTCATACTGTTCTGCCTGAAGAAG ATAACCCTCTTCTCCATCTACTCACCGGCTT

CCCGCACCTTCCGAGCATCCACGGCAAACTTCTTTTTCCCCCTGGTTCTCCTTGTGGGTCTGGCGATCTCTGCAGTTCCCGTGCTTTACAGTATCTTCCT

 GATCCCACCTTCGAAACTGTGTGGCCCGTTCCGCGGGAAGCTGTCCATTTGGGCCCAGATCCCTGAGGCCATTGAGAGCCTCCCTCAGACTGCCCAGAA

TTTTCTCTACTTTCTGGGAACCCAAGCTTTTACTGTACCTCTTCTGATCCTCTCTAG CATCCTGATGATGTATACCGTAGCCCTGGCTAACTGTTACGG

ACGCCTCATCTCTGAGCTCAAACGCCAGATAGAGACG - UNI28533 - GAAGTGCAGAATAAAGTCTTCCTGGCCCAGCGAGCTGTGGCTCTGAGCT

CAAGGAATGGAACTTCCTGATAAGTCTGGCTGAACCTTCAGCCCCTCAGCTTCAGTGACTTCATATCAAGTGATGGGACTCTTTCATCTCTGGAACCAAA

TTCCCCGCCCTCTGCCACCCGAATGCTACACTCTCAATTGAACCGTATTAATAAACAACAGTCAAGGCC
Translation
MESHPSRELPWPMQARRAHR RKSQATGQLASGSESRAAYWTRQLSRTKGKMKEGFQTIQPWAWTLKKIGG GQFGAGTESYFSLLRFLLFLNLVASVIE

ICMKLIPTWLEGAPPGPPGPNISSPCGSYIPHTHGLVAFPTQLFNLLSGE - UNI34232 - GYLEWSPLFYGFYPPRSNLAITYLCSVFAISIIYLL

CILRR - UNI34232 - RSVSGLKETLLAESDILTSYSHRVFSAWNFGLCGDVHVRLRQRIILYELQ - UNI34232 - VDLEEAVVRRRAAEQTL

SQRAKVWSMRALLNVLVLALLGAAFYGIYWATEYTLTLQ ETPLVRQTPLFKLLVDYLPSIFISLFNFVLPPVFKFIASLEGYTQSRQIVLILLR RTVF

LRLASLVFLLVSLWSQITCGGNMEAEGCKACGYNYKEIP CWETRLGQEMYKLVLFDLLMGLLVTLLVQFPRK KILCGLCPGALGRLSGTLEFQVPDEV

LGLIYAQTVVWVGSFFCPLLPLINTAKFLILFCLKK ITLFSIYSPASRTFRASTANFFFPLVLLVGLAISAVPVLYSIFL LIPPSKLCGPFRGKLSIW

AQIPEAIESLPQTAQNFLYFLGTQAFTVPLLILSS SILMMYTVALANCYGRLISELKRQIET - UNI28533 - EVQNKVFLAQRAVALSSRNGTS
Transcript ENSMUST00000038743
Sequence
ATGGAAGCCTGGGGCCAGTCCCCAGCCTGCTCCAGCTCCCGGAAAGCCAGAACAG GCCCATCGCTGGCGTCTGTGCTGAACGATCTCCCCAGCGCTGCT

ACGCTGCGATACCGCGGCCCTGGTGTGCTCCCTTGGGGAACACTGGATGAAGATGATGATGAAGGAGGAAGGAGCCTTCAGGCCTTTGCAGAAACTGCAC

AAATGGAATCTCACCCTTCCCGGGAACTTCCCTGGCCTATGCAGGCAAGGCGGGCACACAG GAAGAGCCAGGCTACAGGGCAGCTGGCTTCTGGCTCTG

AATCCAGGGCTGCCTACTGGACCCGACAGCTTTCCCGGACCAAGGGAAAAATGAAAGAAGGCTTTCAAACTATACAGCCCTGGGCATGGACGCTGAAGAA

AATTGGGG GTCAGTTTGGAGCAGGCACTGAGTCCTACTTCTCCCTGCTGCGCTTCCTGCTCTTTCTCAACCTGGTGGCATCTGTCATTGAAATCTGCAT

GAAGCTGATCCCCACCTGGCTGGAAGGGGCTCCTCCAGGTCCCCCTGGCCCTAACATCTCTTCACCCTGTGGTTCCTATATTCCACACACTCATGGCCTG

GTCGCCTTCCCCACCCAGCTTTTCAACTTGCTCTCTGGAGAG - UNI34232 - GGTTACCTTGAGTGGTCCCCTCTATTCTATGGGTTCTACCCACC

CCGATCGAACCTGGCCATCACCTACCTGTGCTCCGTCTTTGCCATCAGCATCATCTACTTGCTGTGCATCCTACGACG - UNI34232 - TTCGGTGT

CCGGGTTGAAGGAGACACTGTTGGCGGAGTCAGACATTCTGACCAGCTACAGTCACCGAGTGTTCTCAGCTTGGAATTTTGGCCTCTGCGGGGACGTGCA

CGTGCGGCTGCGCCAGCGCATCATTTTGTATGAACTACAG - UNI34232 - GTGGACCTAGAGGAAGCAGTAGTCCGGCGCCGTGCTGCGGAGCAGA

CTCTGAGCCAACGAGCCAAGGTGTGGTCGATGAGGGCGCTGCTCAACGTGCTGGTCCTCGCGCTGCTCGGGGCGGCCTTCTATGGCATCTACTGGGCCAC

CGAGTACACCTTGACACTACAG GAGACGCCCCTTGTCCGACAGACCCCACTATTCAAGCTTCTGGTGGATTATCTACCATCCATCTTCATTTCTCTGTT

CAACTTTGTGCTGCCTCCTGTGTTCAAGTTCATTGCCTCACTAGAGGGCTACACTCAAAGCCGACAGATCGTCTTGATCCTGCTTAG GACTGTGTTTTT

GCGTCTGGCCTCGCTGGTGTTCCTTCTGGTCTCTCTGTGGAGTCAGATCACGTGTGGGGGAAACATGGAGGCAGAAGGATGCAAGGCCTGCGGCTATAAT

TACAAAGAAATTCCG TGCTGGGAGACTCGGCTGGGCCAGGAGATGTACAAACTTGTACTCTTTGATCTGCTGATGGGCCTGTTGGTCACGCTGTTGGTC

CAGTTTCCTAGGAA GATACTCTGTGGCCTCTGTCCTGGGGCACTGGGTCGTCTGTCGGGAACCCTGGAGTTCCAGGTGCCAGATGAGGTGCTGGGGCTC

ATCTATGCGCAGACCGTGGTCTGGGTGGGAAGCTTCTTCTGCCCTTTACTGCCTTTGATCAACACTGCTAAGTTCCTCATACTGTTCTGCCTGAAGAAG 

ATAACCCTCTTCTCCATCTACTCACCGGCTTCCCGCACCTTCCGAGCATCCACGGCAAACTTCTTTTTCCCCCTGGTTCTCCTTGTGGGTCTGGCGATCT

CTGCAGTTCCCGTGCTTTACAGTATCTTCCT GATCCCACCTTCGAAACTGTGTGGCCCGTTCCGCGGGAAGCTGTCCATTTGGGCCCAGATCCCTGAGG

CCATTGAGAGCCTCCCTCAGACTGCCCAGAATTTTCTCTACTTTCTGGGAACCCAAGCTTTTACTGTACCTCTTCTGATCCTCTCTAG CATCCTGATGA

TGTATACCGTAGCCCTGGCTAACTGTTACGGACGCCTCATCTCTGAGCTCAAACGCCAGATAGAGACG - UNI28533 - GAAGTGCAGAATAAAGTC

TTCCTGGCCCAGCGAGCTGTGGCTCTGAGCTCAAGGAATGGAACTTCCTGATAAGTCTGGCTGAACCTTCAGCCCCTCAGCTTCAGTGACTTCATATCAA

GTGATGGGACTCTTTCATCTCTGGAACCAAATTCCCCGCCCTCTGCCACCCGAATGCTACACTCTCAATTGAACCGTATTAATAAACAACAGTCAAGGCC

Translation
MEAWGQSPACSSSRKARTG GPSLASVLNDLPSAATLRYRGPGVLPWGTLDEDDDEGGRSLQAFAETAQMESHPSRELPWPMQARRAHR RKSQATGQLA

SGSESRAAYWTRQLSRTKGKMKEGFQTIQPWAWTLKKIGG GQFGAGTESYFSLLRFLLFLNLVASVIEICMKLIPTWLEGAPPGPPGPNISSPCGSYIP

HTHGLVAFPTQLFNLLSGE - UNI34232 - GYLEWSPLFYGFYPPRSNLAITYLCSVFAISIIYLLCILRR - UNI34232 - RSVSGLKETLLA

ESDILTSYSHRVFSAWNFGLCGDVHVRLRQRIILYELQ - UNI34232 - VDLEEAVVRRRAAEQTLSQRAKVWSMRALLNVLVLALLGAAFYGIYWA

TEYTLTLQ ETPLVRQTPLFKLLVDYLPSIFISLFNFVLPPVFKFIASLEGYTQSRQIVLILLR RTVFLRLASLVFLLVSLWSQITCGGNMEAEGCKAC

GYNYKEIP CWETRLGQEMYKLVLFDLLMGLLVTLLVQFPRK KILCGLCPGALGRLSGTLEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLINTAKFLIL

FCLKK ITLFSIYSPASRTFRASTANFFFPLVLLVGLAISAVPVLYSIFL LIPPSKLCGPFRGKLSIWAQIPEAIESLPQTAQNFLYFLGTQAFTVPLL

ILSS SILMMYTVALANCYGRLISELKRQIET - UNI28533 - EVQNKVFLAQRAVALSSRNGTS

For any suggestions or comments, please send an email to unitrap@crg.es