Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019767 (AC158617.9)
Chromosomal location
Chr 10: 5785430 - 5833846 (-)
Description
not available
UniGene
Mm.291807 
Human Ortholog
ENSG00000120262 (C6orf97)
Omim not available
UniTrap UNI25603
Vector Insertion
Chr 10: 5832486 - 5833660
Public Clones not available
Private Clones OST174114 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21104
Vector Insertion
Chr 10: 5825787 - 5827490
Public Clones not available
Private Clones OST341225 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33157
Vector Insertion
Chr 10: 5812264 - 5825787
Public Clones IST12093G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019901
Sequence
CAGATGACAGACTGTTTAATACTTTTAATGCTTTGTCTTTTGGGGAAACTCTATCAGGGAACTGCCAGTCATCGCCCAGAAGTCCCTGATACCTGGGAAC

AGCTGAACCACTACCGGAATGTGACTGAAAATGTTCAAAGTGAGCTTGCAGCAATGCTGGTCAAATTTGAATGTGCTCAGTCCGAG - UNI25603 - 

CTTCGAGAACTCCGCTCCAAGATGCTTTCTAAAGAAGCTTGCTGTCAGGAGCTGAAGGTGGAAATGGAGAGCTATAAAGAAAGCAGTGCCAGAAAGTCAG

CTCTCCTCACGTCTCTGAGGGGCAGGATGGAGGAGCTCCAGGAGGAATCAGCAGCGGTTTCAGCTTCTAAAAGCAGAGCAGAGGCCTCTGTTCACGCCAT

GATGAAGGAGAACCAGGAACTAATGAAGAAAGTTCTAGAACTGGATGAGAAATTACA AAACTGTTCAAAGGAAAATGAGGAGTCTAAGAAACAAGGCTC

AGAGCACCTCCGGAGGCACGAGGAATTTCGGGCTCAGCTTCATGATTGCTTGAGTCTAGACAAGAAGCATGAAGAGGCATCGGATGAAGATTTAATTTTA

AAG - UNI21104 - - UNI33158 - CTTAGAGAGCTGTACAAGGAGCCCACATTCCTGAAAGGACAGCTCGCTACTCTTGAAGAGACTGTAACTG

TCCATGAGATGGAGGCAAAGGCTAACAGAGAAACTATCAGGAGGCTGGCAGCCGAAGTCAGCAGGGAGCAGACAAAAGCTGCCTCCTGGGCAGAGGAGAA

AGACAAGCTGAATCAG - UNI33158 - GACTTGCTCAGTGCTGTGGAGGGGAGAACAGCTCTAGAAAGGGAAGTGAAGCTCTACCAAGAACGGCTGC

TTGCATCTCAGCGAGCCTGGGATGCCTCGAAGCAGGAGCTGACCCAGCTGAGGAAACGCTGCCAGGAGCTGGATGTGAGCTTGAAGGCCAGCAGGGAGGC

CACCACAGCCTCGCAGAGCCGGAACTCCTGCTTCAGGGAGAAACTCACAGCTCTTCTTTGCAGCAGATTCGACACAGCTGAATCCACAGAGGATGCCATA

TTGGAGAGGATTCGAGAGCTAGGCATTGAGGAGGAGAGCCAGAGAAGG - UNI33158 - ATGGCCTCTCAGCTTGAAGCCCAGATCTCTGAGTTTGT

TGGGAAGTTGGGAAATGAATCTGAGTCTCACCAGAAAGCCCTACAGAGGGCCCATGTGGCAGAAAAGAAGTTGGAGGCTCTTCAGAGTCAGCTGAGTCAC

CTGGAGGGAGAGCTGCTTTCTGGAGACGTCGTGAGAGACAACTTGTTTCTAGAGAAGCAAAAA TATCTGAAGTTTCTGGACCAGCTGACAGAGAAAATG

AAGTTGGGCCACGTAGCTGCTGACCTTGGCTTTGACGTGTGTCTGGATGTAGTTCTAGCTCGCATAGAGCAGTTAGTTCGCCTTGAAAGCAATGCTGTCA

TTGAAAACAAGACCATGGCTCACAACTTACAGAGGAAG CTAAAGACTCAGAAAGAAAGACTGGAGAGCAAAGAAGTTCATATGAACCTCCTTCGGCAGA

AAATTGCCCAGCTGCAGCAGGAGAAAGAGGCGCGCTCAGCCTTGGCTGTGGAGAGGGACGAAGCCCATCTTGCCATGAGGAAGCTGGAGAAGAAGCTGGA

GAGGATGCAGAAGGAGTTGAGTGCGTGTCAGGAGCACAACACTGAGCTCAAAGCCAAACTGGCAGACACCAATGAACTCAAG ATTAAAACCTTGGAACA

GACCAAAGCCATTGAAGATTTAAATCAATCCCGAGACGAGCTGGAGAAGATGAAGGAGAATGCAGAGAAAAAGCTCATGTTGGTCATGTCTGAGCTGGAA

AACACAGAGCAGGAGGCTCGAGCACACCAGGAAAGAAGCAGAGCCATGATAGAGTTGGCCAGCCTTGAACTGAAGACCCTGAGGAAGTCTTTGGATGAAG

CGGAGAGGAGAGGAATGCAG CTGGCAGACTTCAGAGAGGTGGTTTCCAGTATGCTGGGCTTGAACATGACCTCTCACGATCCTCCCGACTATGAGATCA

TCAAGTGTCTGGAAAGACTGCTCCAT TTTGTTCCCTGTGCCTGCCTCCAAGACATGGCTGCTGAGCAAGGCAGCTGCTCACACTGCCGTGTGGAAATTC

CGCATTGA
Translation
QMTDCLILLMLCLLGKLYQGTASHRPEVPDTWEQLNHYRNVTENVQSELAAMLVKFECAQSE - UNI25603 - LRELRSKMLSKEACCQELKVEMES

YKESSARKSALLTSLRGRMEELQEESAAVSASKSRAEASVHAMMKENQELMKKVLELDEKLQ QNCSKENEESKKQGSEHLRRHEEFRAQLHDCLSLDKK

HEEASDEDLILK - UNI21104 - - UNI33158 - LRELYKEPTFLKGQLATLEETVTVHEMEAKANRETIRRLAAEVSREQTKAASWAEEKDKLN

Q - UNI33158 - DLLSAVEGRTALEREVKLYQERLLASQRAWDASKQELTQLRKRCQELDVSLKASREATTASQSRNSCFREKLTALLCSRFDTAES

TEDAILERIRELGIEEESQRR - UNI33158 - MASQLEAQISEFVGKLGNESESHQKALQRAHVAEKKLEALQSQLSHLEGELLSGDVVRDNLFLEK

QK YLKFLDQLTEKMKLGHVAADLGFDVCLDVVLARIEQLVRLESNAVIENKTMAHNLQRK LKTQKERLESKEVHMNLLRQKIAQLQQEKEARSALAVE

RDEAHLAMRKLEKKLERMQKELSACQEHNTELKAKLADTNELK IKTLEQTKAIEDLNQSRDELEKMKENAEKKLMLVMSELENTEQEARAHQERSRAMI

ELASLELKTLRKSLDEAERRGMQ LADFREVVSSMLGLNMTSHDPPDYEIIKCLERLLH FVPCACLQDMAAEQGSCSHCRVEIPH

For any suggestions or comments, please send an email to unitrap@crg.es