Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019785 (Rlbp1l2)
Chromosomal location
Chr 10: 33232092 - 33344575 (-)
Description
retinaldehyde binding protein 1-like 2 Gene [Source:MGI Symbol;Acc:MGI:2443223]
Human Ortholog
not available
Omim not available
UniTrap UNI38190
Vector Insertion
Chr 10: 33315549 - 33342865
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019920
Sequence
TGGAGACCAGAGCAGGCTGAACTTGGGGCTTGGGATATTTGAATGTGTCCCAAAATTCGTTCCTACCCCTACGAGGCAGAGGCAGAGAGAGGAGCGGAGA

GCATGTGTGAGCGCTTACAACGCTAGGAGCTCTCTTCTGGGATAATCAAGAGTTGGGATGAGCCGGATCCTCTTTTAGCAGCAGCGGGCTCAGGAGTGGC

TGCGGAAGCCCCAGGGGCGCGCGGGACCCAGTGGCTCTGGGGGCAGTGGAACAGCCCCTGCGGGCCGCGCCGTGCTACCGCTTAGGCGTACAAAGGTAAA

GGCGGCCGCAGCCCTAGTGGACTTGCACCGTCCCGGCGTTCCCATCCCTTCTCTTCCTCTCTCGAAGGCAAAAAAGGCTGGCCGGGCAGCGAGGTCCTAG

CTCTGCGGGTCCCCACCCTTCCTGCTGACAGGCTGGCTGTCCTTGGATGAGGTCGTCGAGGCTGCTCCCTGGTGAATCCTCAGGCGGGTCTCAGCCACCA

TCTCTCTCCACTGCTCCATCCCTCTGAGAGGAGTAGATGCTGCTGCTGCCCCCACCCCCGCCACCACCTCCGCCAGGGCTGATGGATGCTGGGGAGTGCC

GCATTGCTTAGTGACTCTGCCTCGCGGTTTGCTG - UNI38190 - GAAAGGAAGCAGACAGCAGTGAGGAGAACCGGAGGCCAGAGTGTGGTGTGGA

GGTGACAAGTACCAGGTATATTGTTGGACACACAAAGAGAGAATCAGAGTAGACAGCTTGGATACAAGGGGACAATGACTCATTTGCAAGCTGGCCTCTC

TCCTGAGACTTTGGAAAAAGCTCGCCTGGAACTCAATGAGAACCCAGACACTCTGCACCAGGACATCCAAGAAGTAAGGGACATGGTCATCACTAGGCCG

GACATTGGCTTTCTGCGCACAGATGACGCTTTCATCTTACGCTTCTTGAGGGCCAGGAAATTTCATCACTTCGAAGCTTTTCGCCTCTTGGCCCAGTACT

TTGAGTACCGGCAGCAGAACCTGGATATGTTCAAAAGCTTCAAGGCCACTGACCCTGGCATCAAGCAGGCACTGAAGGATGGCTTTCCTGGGGGCCTGGC

CAATCTGGACCATTATGGGAGGAAGATTTTAGTCCTTTTTGCTGCCAACTGGGATCAGAGCAG - UNI38190 - GTACACACTGGTGGATATTTTGC

GTGCCATCTTACTTTCTTTAGAAGCCATGATTGAAGATCCAGAGCTTCAAGTAAATGGATTTGTTTTGATCATAGACTGGAGTAACTTCACCTTCAAGCA

AGCTTCTAAGCTTACACCAAACATGCTGCGACTTGCAATTGAAGGTCTTCAG - UNI38190 - GACAGCTTCCCAGCAAGATTTGGAGGAATTCATT

TTGTCAATCAACCTTGGTATATCCATGCCCTGTACACTGTGATACGCCCATTCCTGAAAGAGAAGACTCGGAAAAGG ATATTTTTGCATGGTAACAACC

TGAACAGTCTACACCAACTAATTCATCCTGAGATCCTACCTTCTGAGTTTGGAGGAATGTTGCCCCCATATGACATGGGCACATGGGCACGAACCCTGCT

AGACCATGAGTATGATGATGACAGTGAGTACAACGTGGATTCCTATAACATGCCTGTGAAGGACGTGGACAAGGAACTCTCCCCCAAATCCATGAAGAG 

ATCTCAGTCAGTAGTGGACCCTACAGCACTGAAACGAATGGATAAAAGTGAAGAAGAAAACATGCAGCCTTTACTTGCTCTGGACTGAGAACTTCTCCAC

CCCTACACCATGGATTAAAAATGGGAGGTCCTGGCTTTCAGCAACAGGGACAACACTGTGGGATTGACCTGCTGGAAAACTTTACTCATGTTCATGTAGC

ATAATGCACACGACATCTGGCTTTCACATTTGCCTAAACCATGGGTGCCCTGAGCTAGATTTTAAAAAGTCAATAATTTATTCTGTAAGTGCCAAGTTCT

TTGTAAATACAATATTGTGGTCACATCTAGTTTGTAAATTTTGTTAGTAATTTAGTTTGGGAAAGATTGACTCACATGTTTGAGCCAGTGATATGGACTA

CAATAAGAAGCTTAAGGACATGTAACCTATAAAATTTAATTAAATGTATCCCTGTTTCCTATGAAGCCATATATCTGCTATCATAGTGATTATTTCAATA

TTTTCCTACAAAACACTGTCATTATTCAAATATACTTGGGTCACAGAAGGTTAATTATCTCCTGGAAATTGTTATTATTAATGTTTTCCTGCTTAGTAAT

TTTTGTTTCAGAGGAACTTTTCTGGAACCATCACTGGCTGCATTCTGAAGAAAGAAAATGGCTGATGAGCTGGAAAACTGAACCAAATGGCAAATCGTCT

CCGTTGTGTGATTTAGAGTTTTTTTTTTCAAGAAAATGTTTTTTCCCAATTAAGATGAGGAATTCTAAAAAAGAATGGGTTTTTTGTTTTTGTTCGTTTG

TTTTTGTCTAAATGATTGTCTTAACAATGTTCCTTTACTTAAGTTGCCATTGTAACCCCTATCTGATATACTTTAGAATATATTTTCACCCAAAGTAAAT

GAGAGTTAGTTCCTGAATCATTTTGACAATTTTGCACATAAAATTTGTCACTTGAAGATGAGGGCTAATTTCAGATCATTGTGGAAATGTTGAAGATATA

AATAATTACTAACAACATATATAGTTTTATTGACTTTTAATAAATTCTTGATAAGACAGGC
Translation
 - UNI38190 - MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMF

KSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSR - UNI38190 - RYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQ

ASKLTPNMLRLAIEGLQ - UNI38190 - DSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKR IFLHGNNLNSLHQLIHPEILPSEFGGMLPPY

DMGTWARTLLDHEYDDDSEYNVDSYNMPVKDVDKELSPKSMKR RSQSVVDPTALKRMDKSEEENMQPLLALD

For any suggestions or comments, please send an email to unitrap@crg.es