Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019802 (Sec63)
Chromosomal location
Chr 10: 42481302 - 42552316 (+)
Description
SEC63-like (S. cerevisiae) Gene [Source:MGI (curated);Acc:Sec63-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36717
Vector Insertion
Chr 10: 42481695 - 42503247
Public Clones IST10601D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36283
Vector Insertion
Chr 10: 42537889 - 42543686
Public Clones IST14283F6 (tigm) IST12417A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105496
Sequence
ATAGATAACATGAAGTTTAGGCCAAACCTGTTTGTGAATTCATTGGACACCTTTGAGATAGTCTAGCAATTGGCACTCCTCGAACTCAGTGATGACCTCT

GCCTGGTATGTTAAGAACCATGTGGAGTGGTATCCCGAACATTATTTTAAAAGGG - UNI36283 - GAAAAACAAGAGTGGTGGTGGCTTTATATTG

CAGATAGGAAAGAACAAACATTAATATCCATGCCATATCATGTGTGCACACTGAAGGATACAGAAGAG GTAGAACTGAAGTTTCCCGCACCCGGCAAGC

CTGGAAATTATCAGTATACAGTGTTCCTGAGATCAGACTCCTATATGGGCTTGGATCAGATTAAACCACTGAAG TTGGAAGTTCATGAGGCCAAGCCTG

TGCCAGAAAACCACCCACAGTGGGACACAGCGATAGAAGGTGACGAAGACCAGGAAGACAGTGAAGGATTTGAAGACAGCTTTGAGGAAGAGGAGGAGGA

AGAGGAAGGTGGAGACTAACCCGAGTGAGTGGACTACAGCGTTTGCACATCCTTGCAAACATTGCTGCTCTGTGAGAGGTCATAAAGCAGCAGCAGTGAG

GGCTGATATGGAGGGAAGGGTTGCCGACTTTACTAGAAACGGATGCAAAAAAGAGGCCGCTGGTGCCAGGGTACAATCTGAAAAGGGTTTTTAAAGCCTT

TCAGGTATGGGGTGGTGCGTTTATCTCATCTGCAAATGATAATAAATCCTTTGATGTTCCAACTGTCC
Translation
MLRTMWSGIPNIILKG - UNI36283 - EKQEWWWLYIADRKEQTLISMPYHVCTLKDTEE VELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLK 

LEVHEAKPVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEGGD
Transcript ENSMUST00000019937
Sequence
GTGGAGGAGACGGCCGGGGAGGGAACAGCCGCGTGGGGCGGGAACTAGCTCCTCTCGCGAGAGTTGGCGACGGCCGCGGCGGCGGCGGCGGCGTGTCCGT

GAGAGCGGCGTGGGGGCGGGGAGGAGAGCGGCGGCGGCGGCGGCGGCGGCGGCGGTAGCGGCGTCCGAGCTACGCCACACGGGGCCGGGGCGCTGGGAGC

CGGGAGCCGGAGCGCAGCGCGGGGTCGTGGCGACGGCGGTGAGGGGAGCGCGGCGGAGGAGGCGGAGCCATGGCGGGCCAGCAGTTCCAGTACGATGACA

GCGGGAACACCTTCTTCTACTTCCTCACCTCCTTCGTGGGGCTCATCGTGATCCCCGCCACCTACTACCTCTGGCCGCGAGACCAGAACGCGG AGCAAA

TTCGATTAAAGAATATCAGAAAAGTATATGGAAGATGTATGTGGTATCGTTTACGGTTATTAAAACCCCAGCCAAATATTATTCCTACAGTAAA GAAAA

TAGTTCTGCTTGCAGGATGGGCACTGTTCTTATTTCTTGCATACAAAGTTTCCAAAACAGACCGAGAATATCAAGAGTACAATCCTTATGAAGTACTAAA

TTTGGATCCT GGAGCAACAGTGGCAGAAATTAAGAAACAGTATCGCTTGTTGTCACTTAAATATCATCCAGATAAAGGAGGTGATGAAGTCATGTTCAT

GAGGATAGCAAAAGCATATGCAGC TTTAACAGATGAAGAGTCTCGGAAAAATTGGGAAGAATTTGGAAATCCAGATGGGCCTCAAG CTACAAGCTTTG

GAATTGCTTTGCCAGCTTGGATAGTTGACCAGAAAAATTCAATTCTG GTTTTACTTGTGTATGGATTGGCTTTTATGGTTATTCTTCCTGTTGTGGTG 

GGCTCTTGGTGGTATCGGTCAATACGATATAGTGGAGACCAGATTCTAATACGTACAACACAGATTTATACATACTTTGTTTATAAAACTCGAAATATGG

ATATGAAAC GTCTCATCATGGTTTTAGCTGGAGCTTCTGAATTTGACCCTCAGTATAATAAAGATTCCACAAGCAGGCCAACAGATAATATTTTAATAC

CACAG CTAATCAGGGAAATTGGCAGCATAAATTTAAAGAAGAATGAACCTCCACTCACCTGTCCATACAGCCTGAAGGCCAGAGTTCTTTTACTGTCTC

ATCTTGCTAGAATGAAAATTCCTGAGACACTGGAAGAAG ATCAACAGTTCATGCTGAAAAAATGTCCTGCTCTGCTTCAAGAAATGGTTAATGTAATCT

GCCAGCTAATAATAATGGCCCGGAGCCGTGAAG AAAGGGAGTTTCGTGCTCCAACTTTGGCATCCTTAGAAAACTGTATGAAGCTTTCCCAGATGGCTG

TTCAGGGGCTCCAGCAGTTTAAGTCTCCCCTTCTGCAGCTCCCTCATATTGAAGAGGACAATCTTAGGAGAGTTTCGAATCATAAAAAG TACAAAATTA

AAACTATCCAGGATTTGGTTAGTTTAAAAGAATCAGATCGTCATAGTCTGCTACACTTCCTTGAAGATGAAAAGTATGAAGAGGTCATGGCGGTCCTTGG

GAGTTTCCCGTATGTGACCATGGACATAAAATCACAGG TCTTGGATGATGAAGATAGCAACAACATCACAGTAGGATCCCTAGTTACAGTGTTGGTTAA

GTTGACGAGGCAGACCATGGCT GAAGTGTTTGAAAAGGAGCAGTCCATCTGCGCCGCTGAGGAGCAGCCCACAGAAGACGGG CAGAGTGATGCCAACA

AGATCAAGGCAAAAGGAGGATGGCAGCAGAAGAACAAAGGACCCAAGAAAATGCCCAAATCCAAAAAAAAGAAGCCTTTAAAAAAGAAACCCACAACTGT

ACCCTTACCTCAGGCAAAGCAGCAGAAGCAAAAGCAAGCAAATGGAGTTGTTGGGAGT GAAGCTGCAATAAAGGAGGAAGAAGACGACATTTCTGACAA

GGGCAGTGATTCTGAAGAGGAAGAAACCAATAGAGATTCTCAGAGTGAGAAAGAAGATGGTAGTGACAGGGAGTCTGATAGAGAGCAAGATGAGAAACAA

AGCAAAGATGATGAAGCA GAGTGGCAAGAGTTACAACAGAGTATACAGAGGAAAGAGAGAGCTCTTCTGGAGACCAAGTCAAAGATAACACACCCTGTC

TATAGTCTCTACTTTCCTGAG - UNI36283 - GAAAAACAAGAGTGGTGGTGGCTTTATATTGCAGATAGGAAAGAACAAACATTAATATCCATGCC

ATATCATGTGTGCACACTGAAGGATACAGAAGAG GTAGAACTGAAGTTTCCCGCACCCGGCAAGCCTGGAAATTATCAGTATACAGTGTTCCTGAGATC

AGACTCCTATATGGGCTTGGATCAGATTAAACCACTGAAG TTGGAAGTTCATGAGGCCAAGCCTGTGCCAGAAAACCACCCACAGTGGGACACAGCGAT

AGAAGGTGACGAAGACCAGGAAGACAGTGAAGGATTTGAAGACAGCTTTGAGGAAGAGGAGGAGGAAGAGGAAGGTGGAGACTAACCCGAGTGAGTGGAC

TACAGCGTTTGCACATCCTTGCAAACATTGCTGCTCTGTGAGAGGTCATAAAGCAGCAGCAGTGAGGGCTGATATGGAGGGAAGGGTTGCCGACTTTACT

AGAAACGGATGCAAAAAAGAGGCCGCTGGTGCCAGGGTACAATCTGAAAAGGGTTTTTAAAGCCTTTCAGGTATGGGGTGGTGCGTTTATCTCATCTGCA

AATGATAATAAATCCTTTGATGTTCCAACTGTCCAGAAGTGTGGGCTGTGCATTACCTGATAGATTATGCTCTCAGTAAAAGTCAAGGCACATGAAAACA

ATCTATAAATGAGGAGCTCTTCTTTGTTCAGCTTTAGTTTTAGTAAACATTAAAATATGATAAGCATCACACATGTTTTAAGTAATGTCTGCTCAAGTTT

TTAATCTGTTAGTAAGCTCTATTATTCATTTATCAATATTTTACAAATGGTAAGATTGTAACAGTTCCATATGTAAGTTGAAACCATAATTTTCATCTAT

CTTGGCCATAACTTAGCATTCTCACACATTCCACATAATACAGAGGGCTACATTTTAGAATTTTCCATTCTTAATTGCCCAGAGTTAGCAGACGTTATAA

AAGTGGCTTTTATTGGCTTACAGCCTCTTAAAGCCTCTGGTGGTGTCAGTGCAGGATCGAATTAATCCGATAAGCTTCAGGGCCAAAAGTTACTCCGGGA

CCACACGTTCTCTGACGCTCGGTTGATGTCATTCAGCCTTTTGGAAAAGGTTCACTAGAAAAGCTGCACTACATTCGTAGTTTAACCTACCTGACTCTGT

CCGAAGCCTTCTGAAGACAGTAACTACAGCATACAAAGGAGGCACTTTTGTATTCATTTGGACTCCTGTTAATAAAATAGAAGTTTGACTCATTTTATGT

TTGTAATCGTGTGTGTCTTTTTACTCCTAGAGAAAGGGCATAAATAGGGTAATGTTTTATTTTTCAACTCTAAAGTTTAATATTGTACCTCACTGTGGAA

GTGACTGCTATCTCTGTCTACTCTTGGAAAGCCCAGGAGGAAGAACTCTTCTCTCTCATTTAGTACAACCTAAAAGATAGTGCTCAACACAGAGTAGAAA

TGTGTGTGTGATGAGTCACTGAGGTCAGAGGAATATTTTTATTACTAGACATAGAGGACACACACGTCTACAGTACTATAAGACTGACTGCAATAATCCT

ATCAAACTCTCCATAGGCCAAAGTACTGTTGCAATACTAACTTATCACCTGTTTATTTAAAAGGTTGCTACTCTTCCTGCAGAATTATCGCTGGTATTTT

GTTACTACAGTAGTTGGAAATAAAATTTAAAAATTACCAAAAATGAATTTTTTGTTATTGTTCTAAATTTAAGATGTAACATGTAATAGTTGTTCTCACT

GGAACCCTGCTTCCTTCCTCTGCAGGCCCGGGGGTGTGGCTTTGCCTTCAGATCGAGACTGGCTGGGAAGCTCCAGGGTTGGCTGGCGCTGTTAGACGCA

GGCGGGAGGGAGGGAGGGAGGGAGTCAGCTGTGTCAGGTGAGCAGAGATGAACAGCCAGAGCTGTGCTGGTCACATTTCCTAGTTTTCCTGAGGGAGCCA

GGCTCAAGGACCGCTTCTCTAGTGGCTCTTTGCCCTCTGAAAGGTATACAGACTGTTCAAACAACTGGCTTCTCTGGCTTGAGAGTCTCTGGTGAGGATT

TTACACCCTGATAACAGCACCATGCTTACAAAACAGCATGTCTTCCATGATTGGAAATTCCAACAACTTGATTCTGTTTGCCTATGTTGTGATGTGTAGC

AACATCTCAACCTAAAGGACCAGTTTTCCTCTTAACAAGTGCTTTGGGGAAAGACTCCAGCTAGGGTGCTCGTCTCTCTACTCAGTCACTTAACTCCACA

TCCCTATTTTTCTCTGGATTAATAATTTGTCTGAGTTTGCATTTAGTTGAAGGGAGATACAGAGTGAAATTGATTATGAAATTAAGTAGTTTACATTGTG

TAAAAGTTTTAATCTCTAGATCTGCAGAATGTCTGTCAAAATAGAGCTTTCCACAAGGGGTCTTCCTGCTAGTGGAAAGTGTGGCAGGTGCGAAGGCTGA

CATCGGGCCACCTGACTGAGGTCTCAGACCCAAAAGCAGATGTTCGCAGTCTCTAAACTGTTGGGATTTTTGAGAAGACTCGAGACATTGAATTAAGATT

CTGTGTGTGGAGCAATCTCGTTCTTTGCTCTGCCTTTCCCAGCATGCCCTAGGGGTGGAGAAGAACAGGCTGTTGAGTGGTACTGTCCTGCTGTGCTGGG

ACGTTCGGGCCTGTCCGACACCAGTTCCTGCCATGTGGAATGAGGCAGTGTACTGAGGCTTTCTTTGTGTGACTTGATTTGTGTTTTGTTTTTGAGACTC

ACTATATAGCCTTGGCTGGCCTTGACCCACAGTGTAGCCTAGGATGTGGACCTTGTAATCCTCCTCTGGCCTCCGTCTCCGGAGTAATAGGATTACAAGC

AAGAGCCACCACGCCTGGTGTTAACGTATCTGCTACATGTATTCAGGTATCCGCTCCAGCTGCCTCCTACCATACACTGGAGTGTTGTTTAGTAATAATG

TGTATTTCAAATGCACTACATGTTTTTGAGGGATTGTTTATCATGTATTTACTGAATTTCCATGTCCGGGCTCTGTCATTAGGCACTGTAGCTATATGGA

CACTCTCTGTGTTAAGGACTTAACTTGGACTTTTAGTCAGCACATGGTGGGAATTTCTCCTTTCTCCACTGGCACAGTGGCCAATACCTCCCCTTTCCTT

TCCTTTCCTTTCCTTTCCTTTCCTTTCCTTTCCTTTCCTTTCCTTTCCTTTCCTGTTGTTGTTTGTTTGTTTGTTTGCTTGAGCTTGTCACTAGGCAGAG

GAATTCTGTTTGAAGGAACTAGCTATTAAGTTAGGTGGCCTTTGCCTAGCCCCTTATCCCTTTTGAATAAAGCAACATGCATCTTTTGTTGTTAAATGCT

TCTTTTTTGAAGCATTTTCTCGACTCTATGAATCCCCTATTTAGTCTGCCTTAAAGTGAAACAACGACCAGTGAACCGAAGCATGACATTTTACCAGCTG

TGCAGTGGTTAGCTAAGTGTGTCTTGAGATGTTAGCATCATCATGCACTTAAACTTGACACTAGGGCTATTTTACAAACCTTAACAAACAAAACAGATGC

CACCTTGTACATTATCCTGTTACTGAGCTAAAAATCCAAATAGCAATCATGGGCATGCTTTAGAACTGTGGTTTCAGGCAGGGGTATACATCCTGGGGGT

ATGCAGATACTAAGTCCATTGAGAAAATGTTAAAATAATGATTCTTTGTATTTAATCTCATCCTTTTAAATTTCTATTTTTATGTGTTTTATAATGTACA

TAATATATTGTACAGTTGTACACTTATATAATTTATAAATAAATAATACATTTATTGGTGC
Translation
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAE EQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVK KKIVLLAGWALFLFLAYKVSKT

DREYQEYNPYEVLNLDP GATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAA ALTDEESRKNWEEFGNPDGPQA ATSFGIALPAWIVDQKNSIL

 VLLVYGLAFMVILPVVV GSWWYRSIRYSGDQILIRTTQIYTYFVYKTRNMDMKR RLIMVLAGASEFDPQYNKDSTSRPTDNILIPQ LIREIGSINL

KKNEPPLTCPYSLKARVLLLSHLARMKIPETLEED DQQFMLKKCPALLQEMVNVICQLIIMARSREE EREFRAPTLASLENCMKLSQMAVQGLQQFKS

PLLQLPHIEEDNLRRVSNHKK YKIKTIQDLVSLKESDRHSLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQV VLDDEDSNNITVGSLVTVLVKLTRQTM

A EVFEKEQSICAAEEQPTEDG QSDANKIKAKGGWQQKNKGPKKMPKSKKKKPLKKKPTTVPLPQAKQQKQKQANGVVGS EAAIKEEEDDISDKGSDS

EEEETNRDSQSEKEDGSDRESDREQDEKQSKDDEA EWQELQQSIQRKERALLETKSKITHPVYSLYFPE - UNI36283 - EKQEWWWLYIADRKEQ

TLISMPYHVCTLKDTEE VELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLK LEVHEAKPVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEGG

D

For any suggestions or comments, please send an email to unitrap@crg.es