Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019804 (Snx3)
Chromosomal location
Chr 10: 42221836 - 42255187 (+)
Description
sorting nexin 3 Gene [Source:MGI (curated);Acc:Snx3-001]
RefSeq_dna
NM_017472 
RefSeq_peptide
NP_059500.2 
MGI
MGI:1860188 
Uniprot/SWISSPROT
O70492 
Uniprot/SPTREMBL
Q78ZM0 Q9CSC2 Q9CU14 
Human Ortholog
ENSG00000112335 (SNX3)
Omim 601349 - MICROPHTHALMIA, SYNDROMIC 8  
UniTrap UNI7967
Vector Insertion
Chr 10: 42222095 - 42222233
Public Clones RRI229 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22751
Vector Insertion
Chr 10: 42222299 - 42245759
Public Clones IST11559G3 (tigm)
Private Clones OST285654 (lexicon) OST39319 (lexicon) OST28653 (lexicon) OST24307 (lexicon)
OST20304 (lexicon) OST15950 (lexicon) OST13618 (lexicon) OST9693 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26649
Vector Insertion
Chr 10: 42245856 - 42252954
Public Clones not available
Private Clones OST105802 (lexicon) OST61509 (lexicon) OST27633 (lexicon) OST26628 (lexicon)
OST13734 (lexicon) OST7417 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105499
Sequence
GGCGGTGGAGAGAAGCCCGCGGCTGCCGCGGCGACAGCGAAATGGCGGAGACGGTAGCGGACACCCGGCGGCTCATCACCAAGCCGCAGAATCTGAATGA

CGCCTACGGGCCGCCCAGCAACTTCCTCGAGATCGACGTGAGCAACCCGCAGACCGTGGGGGTCGGCCGGGGCCGCTTCACCACCTACGAGATCAGGGTC

AAG - UNI22751 - - UNI26649 - GTTGTAGTTCCCCCACTCCCTGGGAAAGCATTTTTGCGGCAGCTTCCTTTTAGAGGAGACGATGGAATAT

TTGATGACAATTTCATCGAGGAAAGGAAGCAAGGGCTGGAACAGTTCATAAACAA GGTCGCTGGTCATCCTCTGGCCCAGAATGAACGTTGTCTTCACA

TGTTTTTACAGGATGAAATTATAGATAAAAGCTATACTCCATCTAAAATAAGACATGCCTGAGTTTGGTGAGAAGAAGCAAAACCCGAGACCATTAATGA

TTCATCCGCACCAATGAAGAAGTTGTAACTAACTAGCATGCTGCGCAGACACTGGCATAGCATGCCCTGGGTACACTAACACTCACCTGCTCCCTTTCGT

TCCGCTTGTCTTGGCAGTTGACAAGACATTCGTTTGCTTTAGTGAAACTCCCTCGCTCCAGCCTCTCTAAGTAGCTCTTCCCGCTGTGTCCGTGTGCACA

CTGTAGCCCCACAGCCCCGTAGAACCTGCAGTGTCCTGACTAAAGCTGCCGACTTGCTCTCATTTGCAGTTTCTGTGTCATGTTTGCTTCTTGAATCTGA

TTGACTAGAATATTTCTCCCCCCTGCCCCTTGATGTGTGATGTCACCACCTGGTCCTAATTTATGTGCAGGAGCACGACACCACTTGTCTCCAGCGCCAC

ACATCCGAGGTGTACTTTGTGTGCAGAATGTGTCTTCCTTCTGGCCTGTAATCCCCTTCCCATGAAAGATTAATGAGGGAAATCTTTATATTCTGTATAA

AAACAAAATCAAATTTATATACTAAAATCATTTGTCTAAAATTTAAGTTGTTTTCAAATAAAAGTTGAAATGCATTCCTGTGTGC
Translation
MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVK - UNI22751 - - UNI26649 - VVVPPLPGKAFLRQLPFRG

DDGIFDDNFIEERKQGLEQFINK KVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
Transcript ENSMUST00000105500
Sequence
TTGGCGCCCACAGTCCCGTGACGCCGCCGCGCCTCAGCCCCACCCCGCAGTGTCCCTCGGGGCCGCCGCGGGGCCTGCGAACCGGGCGCGGCGTTCAGGC

CAGTCAGCTGTTTCTCCCTGGGCAGAGGGCGGAAGCCCGAGCAGCCTGGGGCGGAGCTTCGCGCGGAACGAACGCCCACCCGTCCTACGTGCTCGTTCGT

CTCCGTTCGCTGCGCGCGAGCCGGGAGTCCCCGCGGCGGGCGGCGGTGGCGTTGGCGGAAGGCGGTGGAGAGAAGCCCGCGGCTGCCGCGGCGACAGCGA

AATGGCGGAGACGGTAGCGGACACCCGGCGGCTCATCACCAAGCCGCAGAATCTGAATGACGCCTACGGGCCGCCCAGCAACTTCCTCGAGATCGAC - 

UNI7967 - - UNI22751 - ACAAATCTTCCTATCTTCAAGCTGAAGGAATCTACTGTTAGAAGAAGATACAGTGACTTTGAGTGGCTTCGAAGTGA

ACTAGAAAGAGAGAGCAAG - UNI26649 - GTTGTAGTTCCCCCACTCCCTGGGAAAGCATTTTTGCGGCAGCTTCCTTTTAGAGGAGACGATGGAA

TATTTGATGACAATTTCATCGAGGAAAGGAAGCAAGGGCTGGAACAGTTCATAAACAA GGTCGCTGGTCATCCTCTGGCCCAGAATGAACGTTGTCTTC

ACATGTTTTTACAGGATGAAATTATAGATAAAAGCTATACTCCATCTAAAATAAGACATGCCTGAGTTTGGTGAGAAGAAGCAAAACCCGAGAC
Translation
MAETVADTRRLITKPQNLNDAYGPPSNFLEID - UNI7967 - - UNI22751 - TNLPIFKLKESTVRRRYSDFEWLRSELERESK - UNI2664

9 - VVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINK KVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
Transcript ENSMUST00000019939
Sequence
GCGAGCCGGGAGTCCCCGCGGCGGGCGGCGGTGGCGTTGGCGGAAGGCGGTGGAGAGAAGCCCGCGGCTGCCGCGGCGACAGCGAAATGGCGGAGACGGT

AGCGGACACCCGGCGGCTCATCACCAAGCCGCAGAATCTGAATGACGCCTACGGGCCGCCCAGCAACTTCCTCGAGATCGACGTGAGCAACCCGCAGACC

GTGGGGGTCGGCCGGGGCCGCTTCACCACCTACGAGATCAGGGTCAAG - UNI22751 - ACAAATCTTCCTATCTTCAAGCTGAAGGAATCTACTGT

TAGAAGAAGATACAGTGACTTTGAGTGGCTTCGAAGTGAACTAGAAAGAGAGAGCAAG - UNI26649 - GTTGTAGTTCCCCCACTCCCTGGGAAAG

CATTTTTGCGGCAGCTTCCTTTTAGAGGAGACGATGGAATATTTGATGACAATTTCATCGAGGAAAGGAAGCAAGGGCTGGAACAGTTCATAAACAA GG

TCGCTGGTCATCCTCTGGCCCAGAATGAACGTTGTCTTCACATGTTTTTACAGGATGAAATTATAGATAAAAGCTATACTCCATCTAAAATAAGACATGC

CTGAGTTTGGTGAGAAGAAGCAAAACCCGAGACCATTAATGATTCATCCGCACCAATGAAGAAGTTGTAACTAACTAGCATGCTGCGCAGACACTGGCAT

AGCATGCCCTGGGTACACTAACACTCACCTGCTCCCTTTCGTTCCGCTTGTCTTGGCAGTTGACAAGACATTCGTTTGCTTTAGTGAAACTCCCTCGCTC

CAGCCTCTCTAAGTAGCTCTTCCCGCTGTGTCCGTGTGCACACTGTAGCCCCACAGCCCCGTAGAACCTGCAGTGTCCTGACTAAAGCTGCCGACTTGCT

CTCATTTGCAGTTTCTGTGTCATGTTTGCTTCTTGAATCTGATTGACTAGAATATTTCTCCCCCCTGCCCCTTGATGTGTGATGTCACCACCTGGTCCTA

ATTTATGTGCAGGAGCACGACACCACTTGTCTCCAGCGCCACACATCCGAGGTGTACTTTGTGTGCAGAATGTGTCTTCCTTCTGGCCTGTAATCCCCTT

CCCATGAAAGATTAATGAGGGAAATCTTTATATTCTGTATAAAAACAAAATCAAATTTATATACTAAAATCATTTGTCTAAAATTTAAGTTGTTTTCAAA

TAAAAGTTGAAATGC
Translation
MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVK - UNI22751 - TNLPIFKLKESTVRRRYSDFEWLRSELERESK

 - UNI26649 - VVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINK KVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA

For any suggestions or comments, please send an email to unitrap@crg.es