Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019813 (2410017P07Rik)
Chromosomal location
Chr 10: 41438649 - 41529681 (-)
Description
RIKEN cDNA 2410017P07 gene Gene [Source:MGI Symbol;Acc:MGI:1915511]
RefSeq_dna
NM_026643 
RefSeq_peptide
NP_080919.3 
UniGene
Mm.338605 
MGI
MGI:1915511 
Uniprot/SWISSPROT
Q8VDS7 
Uniprot/SPTREMBL
B2RR53 Q9D9M1 
Human Ortholog
ENSG00000183137 (C6orf182)
Omim not available
UniTrap UNI1113
Vector Insertion
Chr 10: 41465738 - 41529378
Public Clones (sanger) CC0752 (sanger) M124C10 (ggtc) D158D07 (ggtc) M115A03 (ggtc)
E028E05 (ggtc) 5SE284H05 (ggtc) IST12828E8 (tigm) IST10072G10 (tigm)
IST12061H4 (tigm) IST14572F9 (tigm) IST14318C7 (tigm) IST10894G7 (tigm)
IST10917A4 (tigm) IST13547G11 (tigm) IST11616D4 (tigm) IST14954C3 (tigm)
IST11745D12 (tigm) IST14842A12 (tigm) IST10899D5 (tigm) IST12312C11 (tigm)
IST10871F2 (tigm) IST14440E1 (tigm) IST14432E7 (tigm) IST14946E7 (tigm)
IST14268F5 (tigm) IST14409B8 (tigm) IST10729G4HMF1 (tigm) IST12525D6 (tigm)
IST14924E7 (tigm)
Private Clones OST452219 (lexicon) OST434937 (lexicon) OST434374 (lexicon) OST423223 (lexicon)
OST409133 (lexicon) OST406919 (lexicon) OST406797 (lexicon) OST383578 (lexicon)
OST377953 (lexicon) OST347290 (lexicon) OST317937 (lexicon) OST314694 (lexicon)
OST310267 (lexicon) OST307326 (lexicon) OST300572 (lexicon) OST285451 (lexicon)
OST284294 (lexicon) OST271924 (lexicon) OST263495 (lexicon) OST262597 (lexicon)
OST261678 (lexicon) OST252088 (lexicon) OST251404 (lexicon) OST250240 (lexicon)
OST250160 (lexicon) OST240830 (lexicon) OST238024 (lexicon) OST235142 (lexicon)
OST232871 (lexicon) OST226157 (lexicon) OST221794 (lexicon) OST217311 (lexicon)
OST213551 (lexicon) OST209710 (lexicon) OST203988 (lexicon) OST199964 (lexicon)
OST198612 (lexicon) OST195485 (lexicon) OST195441 (lexicon) OST193898 (lexicon)
OST185992 (lexicon) OST179371 (lexicon) OST156136 (lexicon) OST155193 (lexicon)
OST149855 (lexicon) OST130713 (lexicon) OST127463 (lexicon) OST126147 (lexicon)
OST119455 (lexicon) OST99220 (lexicon) OST56337 (lexicon) OST54159 (lexicon)
OST54093 (lexicon) OST43261 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19569
Vector Insertion
Chr 10: 41463028 - 41465576
Public Clones IST14927F2 (tigm)
Private Clones OST388828 (lexicon) OST207396 (lexicon) OST202437 (lexicon) OST37379 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7185
Vector Insertion
Chr 10: 41460645 - 41460720
Public Clones RRU397 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019951
Sequence
AGGCGCTGGTTTGAAGAAGGGGAAAGAAAAGTAAGGAGTACAGATGCCCGGAGATGTTTATCGAACAAGAAAAGCCGAACAAATAAAG AAACTACAATT

CCCAGATGCCACCGCGACACTTGTCTTTGCCCGCGAACCAACGGTTCTGGAGGCCGTGGTTAACTGGGAGCGTCCATCTG - UNI1113 - ACAATGG

ATTCTGAATTATCACAGAGTATGGTTGGGAGCTATCTTAACCCTCCAGAAAGAATGCATCTTCCATCATTCACGCAAAATGAAGCATTTCAGAATTGCCA

CCCTGGGACCCCTCCTAAAATGTTTAATAGTCCAAACAACCAAG - UNI19569 - CACTTGTTTCAGCATTAAAAACTCTCCAGGAAAAGATTCGTC

GTCTCGAGCTGGAGAGGACACAGGCTGAAGACAACCTGAACCTTCTGTCCAGAGAAGCAGCGCAGTATAAGAAGGCCCTAGAGGAGGAGACCAACGAGAG

GAACCTCGCACACCAGGAGCTGATTAAACAAAAGAAAG ATATAAGCATACAATTAAGCTCAGCCCAGTCTCGTTGTATTCTTCTAGAGAAGCAATTGGA

ATATACAAAAAGAATGGTTCTCAATGTAGAACGAGAAAAGACTATGATCCTAGAACAACAG - UNI7185 - GCCCAGCTTCAAAGGGAAAAAGAACA

AGATCAGATGAAGCTGCACGCTAAACTTGAAAAGCTCCATGTCCTAGAGAAAGAGTGTCTGAGACTGACGGCGACTCGGCAGACTGCGGAG GACAAGAT

TAAATGTCTAGAAGAAAAACTGAAGGAGGAGGAGCATCAGCGCAGGCTGTTTCAAGACAGAGCCTGTGAG AAAACTAACTGCTTAAAACGAGAGCCGCC

TCAGCAAAGGGACCACAAGTTTAGAACACCAACTTTTGAGAGAAAGAAG CCTTTCAGAACAACTTCCCAGGCTAGAGCTAACCCTCAGAGCTCAGGAGA

GCCCGTTTCCATTTGTGACAGTTTGTCTGAACTCTTGATGACAATGGAAGAGGAGCTGGACCAAATGAATAT GGAGCACAGAGAGCTCCTGAGACAGAT

GATGCAGCCTGGGAACCACTCGGTCTCTGAGGACATAGAGCAGGAGCTGGAGCAGTTAGCCAAGAAGATGGAAAGCAAAGGTGACCAGATCTCCAAGCTC

AAGAAGCATCAAGACAGT GTCCGTAAACTGCAGGAAAAAATTGAGAACTCAAGGATAAATGAATCTTCAGGTATCCATGGCAACCCTAAAGGATCTAAG

AACTTAAAAACCAGCCCCCGGAAATGTGTGAGTGAAACCAGCTCTTTTCAGAGAGACAGAGGCTTTCAACCAGTGCAGGTCCACAGCCTGCAGTCGAAGC

TGAGGCGCGATGACATCAAGTGGGAGCAGTGACCAAGGCAAACTGTCTGTCATCTAAATGAACCTCACCAGTGAGACCGCACGCCGTCTCCGTGGTTTTT

ATTTCATATGCTCTTAAGGAACCCTTGAATTATGTTTCTGACTGCTATAAAGTGTGAAGTCGTACATTTTCAGAATAATGGCTAATGACCTACCAGGGTT

CCTGGCATCTAAATGACTGCTTTTCATTGTTGTTAACCAAAGGCCTTGACCTCATGAAGCTCTTTAGAAGCATCTGTTTTGCAGCTCCCATAAGGTAAAT

CCAAGAAGCTGTACTGAATGGATGGATGCTCACTGAAATCAAGGGAGTCTGACCTGTGGGTACTATTCCACAGTTTGATTTTTGCAGGCTGTCTGTCACC

TGTAGATCCACACGGAATGAGCAGAATTCCAGACGTTTGTTTGGTGTCCCTGGAACTGCCACCTTCCCTTGTCTCAGCGGTGCTCATGCTTGCTCTGTTT

GGAAAGGGAGGGCACAGTAATTGTGCAGTTTTGTGAAAATGACCTTAACTCAGCTCTGCTATGACAGCCACTAAATGAGATGCATAACTGATTAACCTTT

GAAGACAGTTCTAATTCGTCTTCCTTCCTCTGCTACGCCCTGTCTCCTTTTAAACTCCAACAATTGATTTTATCTTATATGTTATATGTGATTTACATCC

ATATATGACAATGTAATAGATGTCTAGGACCCAAAAAGGTAATAGGATTCTATAAGACCACAGGAAAACATGAATTAGGTAAATGTGGTATCATCTTTTA

TACTTTAAAATTAGTGATGTCACAATGGATTTCTCTGTTGTATACACATGTTACATAATAAATTTATACTTTTTGCCTTTC
Translation
  - UNI1113 - MDSELSQSMVGSYLNPPERMHLPSFTQNEAFQNCHPGTPPKMFNSPNNQA - UNI19569 - ALVSALKTLQEKIRRLELERTQ

AEDNLNLLSREAAQYKKALEEETNERNLAHQELIKQKKD DISIQLSSAQSRCILLEKQLEYTKRMVLNVEREKTMILEQQ - UNI7185 - AQLQRE

KEQDQMKLHAKLEKLHVLEKECLRLTATRQTAE DKIKCLEEKLKEEEHQRRLFQDRACE KTNCLKREPPQQRDHKFRTPTFERKK PFRTTSQARANP

QSSGEPVSICDSLSELLMTMEEELDQMNM MEHRELLRQMMQPGNHSVSEDIEQELEQLAKKMESKGDQISKLKKHQDS VRKLQEKIENSRINESSGIH

GNPKGSKNLKTSPRKCVSETSSFQRDRGFQPVQVHSLQSKLRRDDIKWEQ
Transcript ENSMUST00000105504
Sequence
TTTCCCACAGACAATGGATTCTGAATTATCACAGAGTATGGTTGGGAGCTATCTTAACCCTCCAGAAAGAATGCATCTTCCATCATTCACGCAAAATGAA

GCATTTCAGAATTGCCACCCTGGGACCCCTCCTAAAATGTTTAATAGTCCAAACAACCAAG - UNI7185 - - UNI19569 - AGAAGCAATTGGA

ATATACAAAAAGAATGGTTCTCAATGTAGAACGAGAAAAGACTATGATCCTAGAACAACAG - UNI7185 - GCCCAGCTTCAAAGGGAAAAAGAACA

AGATCAGATGAAGCTGCACGCTAAACTTGAAAAGCTCCATGTCCTAGAGAAAGAGTGTCTGAGACTGACGGCGACTCGGCAGACTGCGGAG GACAAGAT

TAAATGTCTAGAAGAAAAACTGAAGGAGGAGGAGCATCAGCGCAGGCTGTTTCAAGACAGAGCCTGTGAG CTTCAAACTGGATTTGAAATCAGCAAAAT

TTTAATGTCCACAGTTTCGAATTCAAAGCATTGTAAGGAAAAGAAGAAACAGCCAAAG AAAACTAACTGCTTAAAACGAGAGCCGCCTCAGCAAAGGGA

CCACAAGTTTAGAACACCAACTTTTGAGAGAAAGAAG CCTTTCAGAACAACTTCCCAGGCTAGAGCTAACCCTCAGAGCTCAGGAGAGCCCGTTTCCAT

TTGTGACAGTTTGTCTGAACTCTTGATGACAATGGAAGAGGAGCTGGACCAAATGAATAT GGAGCACAGAGAGCTCCTGAGACAGATGATGCAGCCTGG

GAACCACTCGGTCTCTGAGGACATAGAGCAGGAGCTGGAGCAGTTAGCCAAGAAGATGGAAAGCAAAGGTGACCAGATCTCCAAGCTCAAGAAGCATCAA

GACAGT GTCCGTAAACTGCAGGAAAAAATTGAGAACTCAAGGATAAATGAATCTTCAGGTATCCATGGCAACCCTAAAGGATCTAAGAACTTAAAAACC

AGCCCCCGGAAATGTGTGAGTGAAACCAGCTCTTTTCAGAGAGACAGAGGCTTTCAACCAGTGCAGGTCCACAGCCTGCAGTCGAAGCTGAGGCGCGATG

ACATCAAGTGGGAGCAGTGACCAAGGCAAACTGTCTGTCATCTAAATGAACCTCACCAGTGAGACCGCACGCCGTCTCCGTGGTTTTTATTTCATATGCT

CTTAAGGAACCCTTGAATTATGTTTCTGACTGCTATAAAGTGTGAAGTCGTACATTTTCAGAATAATGGCTAATGACCTACCAGGGTTCCTGGCATCTAA

ATGACTGCTTTTCATTGTTGTTAACCAAAGGCCTTGACCTCATGAAGCTCTTTAGAAGCATCTGTTTTGCAGCTCCCATAAGGTAAATCCAAGAAGCTGT

ACTGAATGGATGGATGCTCACTGAAATCAAGGGAGTCTGACCTGTGGGTACTATTCCACAGTTTGATTTTTGCAGGCTGTCTGTCACCTGTAGATCCACA

CGGAATGAGCAGAATTCCAGACGTTTGTTTGGTGTCCCTGGAACTGCCACCTTCCCTTGTCTCAGCGGTGCTCATGCTTGCTCTGTTTGGAAAGGGAGGG

CACAGTAATTGTGCAGTTTTGTGAAAATGACCTTAACTCAGCTCTGCTATGACAGCCACTAAATGAGATGCATAACTGATTAACCTTTGAAGACAGTTCT

AATTCGTCTTCCTTCCTCTGCTACGCCCTGTCTCCTTTTAAACTCCAACAATTGATTTTATCTTATATGTTATATGTGATTTACATCCATATATGACAAT

GTAATAGATGTCTAGGACCCAAAAAGGTAATAGGATTCTATAAGACCACAGGAAAACATGAATTAGGTAAATGTGGTATCATCTTTTATACTTTAAAATT

AGTGATGTCACAATGGATTTCTCTGTTGTATACACATGTTACATAATAAATTTATACTTTTTGCCTTTCTAA
Translation
MDSELSQSMVGSYLNPPERMHLPSFTQNEAFQNCHPGTPPKMFNSPNNQE - UNI7185 - - UNI19569 - EKQLEYTKRMVLNVEREKTMILEQ

Q - UNI7185 - AQLQREKEQDQMKLHAKLEKLHVLEKECLRLTATRQTAE DKIKCLEEKLKEEEHQRRLFQDRACE LQTGFEISKILMSTVSNSK

HCKEKKKQPK KTNCLKREPPQQRDHKFRTPTFERKK PFRTTSQARANPQSSGEPVSICDSLSELLMTMEEELDQMNM MEHRELLRQMMQPGNHSVSE

DIEQELEQLAKKMESKGDQISKLKKHQDS VRKLQEKIENSRINESSGIHGNPKGSKNLKTSPRKCVSETSSFQRDRGFQPVQVHSLQSKLRRDDIKWEQ

Transcript ENSMUST00000105505
Sequence
TTTCCCACAGACAATGGATTCTGAATTATCACAGAGTATGGTTGGGAGCTATCTTAACCCTCCAGAAAGAATGCATCTTCCATCATTCACGCAAAATGAA

GCATTTCAGAATTGCCACCCTGGGACCCCTCCTAAAATGTTTAATAGTCCAAACAACCAAG - UNI19569 - CACTTGTTTCAGCATTAAAAACTCT

CCAGGAAAAGATTCGTCGTCTCGAGCTGGAGAGGACACAGGCTGAAGACAACCTGAACCTTCTGTCCAGAGAAGCAGCGCAGTATAAGAAGGCCCTAGAG

GAGGAGACCAACGAGAGGAACCTCGCACACCAGGAGCTGATTAAACAAAAGAAAG ATATAAGCATACAATTAAGCTCAGCCCAGTCTCGTTGTATTCTT

CTAGAGAAGCAATTGGAATATACAAAAAGAATGGTTCTCAATGTAGAACGAGAAAAGACTATGATCCTAGAACAACAG - UNI7185 - GCCCAGCTT

CAAAGGGAAAAAGAACAAGATCAGATGAAGCTGCACGCTAAACTTGAAAAGCTCCATGTCCTAGAGAAAGAGTGTCTGAGACTGACGGCGACTCGGCAGA

CTGCGGAG GACAAGATTAAATGTCTAGAAGAAAAACTGAAGGAGGAGGAGCATCAGCGCAGGCTGTTTCAAGACAGAGCCTGTGAG AAAACTAACTGC

TTAAAACGAGAGCCGCCTCAGCAAAGGGACCACAAGTTTAGAACACCAACTTTTGAGAGAAAGAAG CCTTTCAGAACAACTTCCCAGGCTAGAGCTAAC

CCTCAGAGCTCAGGAGAGCCCGTTTCCATTTGTGACAGTTTGTCTGAACTCTTGATGACAATGGAAGAGGAGCTGGACCAAATGAATAT GGAGCACAGA

GAGCTCCTGAGACAGATGATGCAGCCTGGGAACCACTCGGTCTCTGAGGACATAGAGCAGGAGCTGGAGCAGTTAGCCAAGAAGATGGAAAGCAAAGGTG

ACCAGATCTCCAAGCTCAAGAAGCATCAAGACAGT GTCCGTAAACTGCAGGAAAAAATTGAGAACTCAAGGATAAATGAATCTTCAGGTATCCATGGCA

ACCCTAAAGGATCTAAGAACTTAAAAACCAGCCCCCGGAAATGTGTGAGTGAAACCAGCTCTTTTCAGAGAGACAGAGGCTTTCAACCAGTGCAGGTCCA

CAGCCTGCAGTCGAAGCTGAGGCGCGATGACATCAAGTGGGAGCAGTGACCAAGGCAAACTGTCTGTCATCTAAATGAACCTCACCAGTGAGACCGCACG

CCGTCTCCGTGGTTTTTATTTCATATGCTCTTAAGGAACCCTTGAATTATGTTTCTGACTGCTATAAAGTGTGAAGTCGTACATTTTCAGAATAATGGCT

AATGACCTACCAGGGTTCCTGGCATCTAAATGACTGCTTTTCATTGTTGTTAACCAAAGGCCTTGACCTCATGAAGCTCTTTAGAAGCATCTGTTTTGCA

GCTCCCATAAGGTAAATCCAAGAAGCTGTACTGAATGGATGGATGCTCACTGAAATCAAGGGAGTCTGACCTGTGGGTACTATTCCACAGTTTGATTTTT

GCAGGCTGTCTGTCACCTGTAGATCCACACGGAATGAGCAGAATTCCAGACGTTTGTTTGGTGTCCCTGGAACTGCCACCTTCCCTTGTCTCAGCGGTGC

TCATGCTTGCTCTGTTTGGAAAGGGAGGGCACAGTAATTGTGCAGTTTTGTGAAAATGACCTTAACTCAGCTCTGCTATGACAGCCACTAAATGAGATGC

ATAACTGATTAACCTTTGAAGACAGTTCTAATTCGTCTTCCTTCCTCTGCTACGCCCTGTCTCCTTTTAAACTCCAACAATTGATTTTATCTTATATGTT

ATATGTGATTTACATCCATATATGACAATGTAATAGATGTCTAGGACCCAAAAAGGTAATAGGATTCTATAAGACCACAGGAAAACATGAATTAGGTAAA

TGTGGTATCATCTTTTATACTTTAAAATTAGTGATGTCACAATGGATTTCTCTGTTGTATACACATGTTACATAATAAATTTATACTTTTTGCCTTTCTA

A
Translation
MDSELSQSMVGSYLNPPERMHLPSFTQNEAFQNCHPGTPPKMFNSPNNQA - UNI19569 - ALVSALKTLQEKIRRLELERTQAEDNLNLLSREAAQ

YKKALEEETNERNLAHQELIKQKKD DISIQLSSAQSRCILLEKQLEYTKRMVLNVEREKTMILEQQ - UNI7185 - AQLQREKEQDQMKLHAKLEK

LHVLEKECLRLTATRQTAE DKIKCLEEKLKEEEHQRRLFQDRACE KTNCLKREPPQQRDHKFRTPTFERKK PFRTTSQARANPQSSGEPVSICDSLS

ELLMTMEEELDQMNM MEHRELLRQMMQPGNHSVSEDIEQELEQLAKKMESKGDQISKLKKHQDS VRKLQEKIENSRINESSGIHGNPKGSKNLKTSPR

KCVSETSSFQRDRGFQPVQVHSLQSKLRRDDIKWEQ

For any suggestions or comments, please send an email to unitrap@crg.es