Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019831 (Wasf1)
Chromosomal location
Chr 10: 40603379 - 40658376 (+)
Description
WASP family 1 Gene [Source:MGI (curated);Acc:Wasf1-001]
RefSeq_dna
NM_031877 
RefSeq_peptide
NP_114083.1 
UniGene
Mm.41353 
MGI
MGI:1890563 
Uniprot/SWISSPROT
Q8R5H6 
Human Ortholog
ENSG00000112290 (WASF1)
Omim not available
UniTrap UNI12322
Vector Insertion
Chr 10: 40603877 - 40640053
Public Clones F15315 (ggtc) IST10610A9 (tigm) IST14185B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20643
Vector Insertion
Chr 10: 40640053 - 40640215
Public Clones not available
Private Clones OST355961 (lexicon) OST307619 (lexicon) OST261407 (lexicon) OST253040 (lexicon)
OST253039 (lexicon) OST253029 (lexicon) OST253028 (lexicon) OST253025 (lexicon)
OST253016 (lexicon) OST253009 (lexicon) OST253008 (lexicon) OST253007 (lexicon)
OST253002 (lexicon) OST253000 (lexicon) OST252999 (lexicon) OST252997 (lexicon)
OST252996 (lexicon) OST252991 (lexicon) OST252990 (lexicon) OST252987 (lexicon)
OST252985 (lexicon) OST252984 (lexicon) OST252979 (lexicon) OST252977 (lexicon)
OST252976 (lexicon) OST252973 (lexicon) OST252572 (lexicon) OST244053 (lexicon)
OST238141 (lexicon) OST171620 (lexicon) OST144129 (lexicon) OST66260 (lexicon)
OST33757 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19431
Vector Insertion
Chr 10: 40640215 - 40646289
Public Clones not available
Private Clones OST391281 (lexicon) OST232899 (lexicon) OST217601 (lexicon) OST67934 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23565
Vector Insertion
Chr 10: 40651840 - 40652918
Public Clones not available
Private Clones OST253032 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105509
Sequence
AGGGCAGCGGCTGCTCGCGGTGTTGTTCGCTCGCGCGTCGAGCGCACCGCGGCTCGGGCGAGCAGTGGGCGCCCCCGGCGGCATTCCCGGCGGCCCGGCG

CCTCAGCCAGTGCCCGGCGCGGCTTCCATCCCGCAGCCCGACGCTCCCGAGGGGCTCCTGGTGGCGCCCCAGTGCGGAGCCGGACCGGCGGCAGCCGCCG

AAGCATGTAGAAGGGGTACGGCGCGAGCCCCCCACGGTTTCGCG - UNI12322 - - UNI20643 - GTGAGCTGGTTCAGTGGCTGAGCTCAAGA

TGCCGTTGGTGAAAAGAAACATCGACCCTCGGCACTTGTGCCACACAGCACTGCCCAGGGGCATTAAGAACGAACTGGAATGTGTAACCAACATTTCCCT

GGCAAATATAATTAGACAACTGAGTAGCCTAA - UNI19431 - - UNI20643 - GTAAGTATGCTGAAGACATATTTGGAGAATTATTCAATGAA

GCACACAGTTTTTCCTTCAGAGTTAACTCGTTGCAAGAGCGCGTGGACCGATTGTCTGTTAGTGTCACACAGCTTGATCCTAAGGAGGAAGAAC TGTCT

TTGCAAGATATAACGATGAGAAAGGCTTTCCGGAGCTCCACAATTCAAGATCAGCAGCTTTTCGACCGCAAGACGTTGCCTATTCCATTGCAAGAAACAT

ACGATGTGTGTGAGCAACCTCCGCCTCTCAATATCCTCACCCCTTACAG GGATGATGGTAAGGAAGGGCTGAAGTTTTATACCAATCCTTCATATTTCT

TTGATCTGTGGAAAGAAAAGATGTTGCAAGATACAGAGGACAAGAGGAAGGAAAAGAGAAAGCAGAAG - UNI23565 - CAGAAAAATCTAGACCGT

CCTCATGAACCAGAGAAAGTGCCAAGAGCACCTCATGACAGGCGGCGGGAATGGCAGAAGCTGGCCCAAGGTCCAGAGCTGGCTGAGGATGACGCTGACC

TCCTACACAAGCATATTGAAGTTGCCAATGGCCCAGCCTCTCATTATGAGACAAG GCCACAGACATACGTGGATCATATGGACGGATCGTACTCACTCT

CTGCCTTGCCATTCAGTCAGATGAGTGAACTTCTGACCAGAGCTGAGGAGAGGGTCTTAGTCAGACCCCATGAACCTCCTCCGCCTCCACCAATGCATGG

AGCAGGAGATGCAAAGCCCACACCCACCTGTATCAG TTCTGCTACAGGTTTGATAGAGAATCGCCCCCAGTCCCCAGCTGCAGGCAGAACACCTGTGTT

TGTGAGCCCCACTCCCCCACCTCCTCCCCCACCTCTTCCGTCTGCCTTGTCCACTTCTTCACTAAGAGCTTCAATGACCTCAACTCCTCCCCCACCAGTC

CCTCCTCCGCCTCCTCCCCCAGCCACTGCTTTGCAGGCCCCAGCAGTGCCCCCACCTCCGGCTCCTCTTCAGATTGCCCCTGGTGTTCTTCACCCAGCTC

CTCCTCCAATTGCTCCTCCTCTAGTGCAGCCCTCTCCCCCAGTAGCTCGAGCTGCCCCAGTATGCGAGACTGTGCCAGTTCACCCACTCCCGCAAGGTGA

AGTGCAGGGGCTGCCTCCACCCCCACCACCGCCTCCTCTACCTCCGCCTGGCATCCGGCCATCATCTCCTGTCGCAGTTGCAGCTCTTGCTCATCCTCCC

TCTGGGCTCCATCCAGCACCATCTACTGCCCCGGGTCCCCATGCTCCATTAATGCCTCCATCTCCTCCATCACAAGTTCTACCTGCCTCTGAGCCAAAGC

GCCATCCATCCACCCTGCCTGTAATCAGTGACGCAAGGAGTGTGCTGCTGGAAGCCATCCGAAAAG GTATTCAGCTTCGCAAAGTGGAAGAGCAGCGTG

AACAGGAAGCAAAACACGAGCGGATTGAAAACGACGTGGCCACCATCCTGTCTCGCCGCATTGCTGTGGAGTATAGCGACTCGGAAGATGACTCGGAGTT

CGATGAAGTAGACTGGCTGGAGTAAGAAAGCCACAGTGACTTGGAAGATGACTCGGAGTTCGATGAAGTAGACTGGATGGAGTAAGACAGCCGCCTTGCT

CTGTATTGCAAGGCTGAATGCACATGTCCCTCGTGGCGCTTGTTCTTTGAAAATGTTCGGTCATTCTAGTGTTTTGCTTCCTATTCCTCATAATGAATAA

CCCTTTTCCTCCATTATTTTTGATTTCTATGAAAAGTATTAGCATATATTTCAAACTAAATATTTTGTGGCTTACCTTAATTTTTCCCCCTGGAAAAATA

TAATTTGGTCCAATAAACTACTAAGTATTAAGCATGGAAAGCCGTTATTAGAGTAGCAGATTCAGTTTTTGATATTCCTTAATTGTGCACTTTGTGATTT

TTTTTTTTTTTTTTAAATTTGAAGAACGCAACTGAGACTGGAATCTTGAAGGCAGCTGTGTCTGGGAACGAGCCTTATTCCGTTTCTTGATGTTTTAAAT

GAAGAAACACTGCCTCGATTATATGAATACACTCAGAAGGAACATGTAGCTTGTAGTGTTGAATTCTCTTAAAGGAATGGTTAGCTTTGGTTATCATTTT

GTTGTTTTTGAATACTTGCCTTATTTGAACGTTTAGCAGAACCCCTTCCCACTTATATATTGTGTGGTACAGTTTTGCTTGCCTATAGAAGTTTAAATTT

TTCCATGTGAAATACTCAGAATAAGCATATGTGTGACTTACATAATGTGAGAATTACAATCTGATGTAATAAACGGTTCATTTTAAAGGCTC
Translation
 - UNI12322 - - UNI20643 - MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLS - UNI19431 - - UNI20643 - S

KYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEEL LSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYR R

DDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK - UNI23565 - QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDADLLHKHIEV

ANGPASHYETR RPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPTPTCIS SSATGLIENRPQSPAAGRTPVFVSPT

PPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGL

PPPPPPPPLPPPGIRPSSPVAVAALAHPPSGLHPAPSTAPGPHAPLMPPSPPSQVLPASEPKRHPSTLPVISDARSVLLEAIRKG GIQLRKVEEQREQE

AKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE
Transcript ENSMUST00000019975
Sequence
GGACAGGGGGAAGCGCCGTCCTCTTGCCCACGGACGG - UNI12322 - - UNI20643 - GTGAGCTGGTTCAGTGGCTGAGCTCAAGATGCCGTT

GGTGAAAAGAAACATCGACCCTCGGCACTTGTGCCACACAGCACTGCCCAGGGGCATTAAGAACGAACTGGAATGTGTAACCAACATTTCCCTGGCAAAT

ATAATTAGACAACTGAGTAGCCTAA - UNI19431 - - UNI20643 - GTAAGTATGCTGAAGACATATTTGGAGAATTATTCAATGAAGCACACA

GTTTTTCCTTCAGAGTTAACTCGTTGCAAGAGCGCGTGGACCGATTGTCTGTTAGTGTCACACAGCTTGATCCTAAGGAGGAAGAAC TGTCTTTGCAAG

ATATAACGATGAGAAAGGCTTTCCGGAGCTCCACAATTCAAGATCAGCAGCTTTTCGACCGCAAGACGTTGCCTATTCCATTGCAAGAAACATACGATGT

GTGTGAGCAACCTCCGCCTCTCAATATCCTCACCCCTTACAG GGATGATGGTAAGGAAGGGCTGAAGTTTTATACCAATCCTTCATATTTCTTTGATCT

GTGGAAAGAAAAGATGTTGCAAGATACAGAGGACAAGAGGAAGGAAAAGAGAAAGCAGAAG - UNI23565 - CAGAAAAATCTAGACCGTCCTCATG

AACCAGAGAAAGTGCCAAGAGCACCTCATGACAGGCGGCGGGAATGGCAGAAGCTGGCCCAAGGTCCAGAGCTGGCTGAGGATGACGCTGACCTCCTACA

CAAGCATATTGAAGTTGCCAATGGCCCAGCCTCTCATTATGAGACAAG GCCACAGACATACGTGGATCATATGGACGGATCGTACTCACTCTCTGCCTT

GCCATTCAGTCAGATGAGTGAACTTCTGACCAGAGCTGAGGAGAGGGTCTTAGTCAGACCCCATGAACCTCCTCCGCCTCCACCAATGCATGGAGCAGGA

GATGCAAAGCCCACACCCACCTGTATCAG TTCTGCTACAGGTTTGATAGAGAATCGCCCCCAGTCCCCAGCTGCAGGCAGAACACCTGTGTTTGTGAGC

CCCACTCCCCCACCTCCTCCCCCACCTCTTCCGTCTGCCTTGTCCACTTCTTCACTAAGAGCTTCAATGACCTCAACTCCTCCCCCACCAGTCCCTCCTC

CGCCTCCTCCCCCAGCCACTGCTTTGCAGGCCCCAGCAGTGCCCCCACCTCCGGCTCCTCTTCAGATTGCCCCTGGTGTTCTTCACCCAGCTCCTCCTCC

AATTGCTCCTCCTCTAGTGCAGCCCTCTCCCCCAGTAGCTCGAGCTGCCCCAGTATGCGAGACTGTGCCAGTTCACCCACTCCCGCAAGGTGAAGTGCAG

GGGCTGCCTCCACCCCCACCACCGCCTCCTCTACCTCCGCCTGGCATCCGGCCATCATCTCCTGTCGCAGTTGCAGCTCTTGCTCATCCTCCCTCTGGGC

TCCATCCAGCACCATCTACTGCCCCGGGTCCCCATGCTCCATTAATGCCTCCATCTCCTCCATCACAAGTTCTACCTGCCTCTGAGCCAAAGCGCCATCC

ATCCACCCTGCCTGTAATCAGTGACGCAAGGAGTGTGCTGCTGGAAGCCATCCGAAAAG GTATTCAGCTTCGCAAAGTGGAAGAGCAGCGTGAACAGGA

AGCAAAACACGAGCGGATTGAAAACGACGTGGCCACCATCCTGTCTCGCCGCATTGCTGTGGAGTATAGCGACTCGGAAGATGACTCGGAGTTCGATGAA

GTAGACTGGCTGGAGTAAGAAAGCCACAGTGACTTGGAAGATGACTCGGAGTTCGATGAAGTAGACTGGATGGAGTAAGACAGCCGCCTTGCTCTGTATT

GCAAGGCTGAATGCACATGTCCCTCGTGGCGCTTGTTCTTTGAAAATGTTCGGTCATTCTAGTGTTTTGCTTCCTATTCCTCATAATGAATAACCCTTTT

CCTCCATTATTTTTGATTTCTATGAAAAGTATTAGCATATATTTCAAACTAAATATTTTGTGGCTTACCTTAATTTTTCCCCCTGGAAAAATATAATTTG

GTCCAATAAACTACTAAGTATTAAGCATGGAAAGCCGTTATTAGAGTAGCAGATTCAGTTTTTGATATTCCTTAATTGTGCACTTTGTGATTTTTTTTTT

TTTTTTTAAATTTGAAGAACGCAACTGAGACTGGAATCTTGAAGGCAGCTGTGTCTGGGAACGAGCCTTATTCCGTTTCTTGATGTTTTAAATGAAGAAA

CACTGCCTCGATTATATGAATACACTCAGAAGGAACATGTAGCTTGTAGTGTTGAATTCTCTTAAAGGAATGGTTAGCTTTGGTTATCATTTTGTTGTTT

TTGAATACTTGCCTTATTTGAACGTTTAGCAGAACCCCTTCCCACTTATATATTGTGTGGTACAGTTTTGCTTGCCTATAGAAGTTTAAATTTTTCCATG

TGAAATACTCAGAATAAGCATATGTGTGACTTACATAATGTGAGAATTACAATCTGATGTAATAAACGGTTCATTTTAAAGG
Translation
 - UNI12322 - - UNI20643 - MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLS - UNI19431 - - UNI20643 - S

KYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEEL LSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYR R

DDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK - UNI23565 - QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDADLLHKHIEV

ANGPASHYETR RPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPTPTCIS SSATGLIENRPQSPAAGRTPVFVSPT

PPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGL

PPPPPPPPLPPPGIRPSSPVAVAALAHPPSGLHPAPSTAPGPHAPLMPPSPPSQVLPASEPKRHPSTLPVISDARSVLLEAIRKG GIQLRKVEEQREQE

AKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE

For any suggestions or comments, please send an email to unitrap@crg.es