Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019846 (Lama4)
Chromosomal location
Chr 10: 38685383 - 38829987 (+)
Description
laminin, alpha 4 Gene [Source:MGI Symbol;Acc:MGI:109321]
RefSeq_dna
NM_010681 
RefSeq_peptide
NP_034811.2 
MGI
MGI:109321 
Uniprot/SWISSPROT
P97927 
Uniprot/SPTREMBL
Q14BF2 Q3ULY0 Q6PHW3 Q8BSJ0 Q91VV0 Q91YG8 
Human Ortholog
ENSG00000112769 (LAMA4)
Omim not available
UniTrap UNI14117
Vector Insertion
Chr 10: 38825888 - 38829693
Public Clones CMHD-GT_114C12-3 (cmhd) CMHD-GT_97H4-3 (cmhd)
Private Clones OST19036 (lexicon) OST2755 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019992
Sequence
GCCGCCAGGGAGAGGAGGTGGCCAGGAGCGCTCGCCTCGCTCATGCCAGTCTGCTCCCCTGCCTTTTGATGTTCACAGGGCGCTAGCTCCATCCATCTGT

AAGTCCCAGAACCCAAGTCTCAGGAGCGGCGGGAGACCGGAGACAAAGTGAGAGAGGTGGATGGAAGCGAAAGACAAGCAGGAGAGAGAGAAGAGACCAC

GCTGACTCTCACTCCCTCTTCTTTAATACAACAAAGTTGCAACTTGGGCTCCTGGATCTAAATACCGCAGGTCCAGAGAAGACAAAACACCAGGCATCAC

TGCATCTCTTAGGGGGTACCCACCAAGACCTCCAGGTCCTTCACTCCAGGAAGGGCCCTGTTGAATATCTGCAGAGAGATGGGTTGGAGCACAGCTTGGT

GCTCAGTCCTGGCCCTGTGGCTCCTCTGGTGTGCTGTCTGCTCCAACGCAGCGTCAGGGGACGGCAATGCGTTTCCTTTTGACATCGAGGGGAGCGCAGT

GGTCGGCAGGCAAGACCCATCGGAGACTAGCGACTCAGGCGTGACACTGGGACGCCTGCCGCCTGCTGCTGAG AGATGTGACGCTGGATTCTTCCGCAC

ACTGTCAGGAGAATGTGCACCCTGTGACTGTAATGGCAATTCCCATGAGTGCTTGGATGGCTCCGGATTCTGTCTG CACTGCCAGCGGAACACAACAGG

AGAGCACTGTGAAAAATGTCTGGATGGCTATATTGGAGACTCCATCAGAGGCACACCCCGGTTCTGCCAGCCGTGCCCCTGTCCCTTGCCCCACCTGGCC

AA CTTTGCAGAATCCTGCTACAGGAAAAATGGAGCTGTTCGGTGTATTTGTAAAGAAAACTATGTTGGACCTAACTGTGAAAG ATGTGCTCCTGGTTA

CTATGGAAACCCCTTACTCATTGGAAGCACCTGTAAGAAATGTGACTGCAGTGGAAATTCGGATCCCAACCTGATCTTTGAAGACTGTGATGAAATCACT

GGCCAGTGCAGGAACTGCTTACGAAATACCACCGGATTCAAGTGTGAACGCTGTGCACCTGGTTACTATGGAGACGCCAGGACAGCCAAGAACTGTGCAG

 TGTGCAACTGTGGGGGCGGCCCGTGTGACAGTGTAACCGGAGAGTGCTTGGAAGAAGGATTTGAAGTCCCTACAG GCTGTGATAAGTGCGTCTGGGAC

TTGACCGATGACCTGCGATTAGCAGCGCTCTCCATCGAAGAGAGCAAATCCGGGCTGCTGAGCGTGTCCTCTGGCGCTGCGGCGCATAGACACGTGACCG

ACATGAACTCTACCATCCACCTCCTCAGA ACAAGGCTGTCAGAAAGAGAAAACCAGTATACCCTAAGAAAGATACAGATAAACAACTCGGAGAACACAC

TGAGAAGCCTCCTGCCTGATGTAGAGGGACTCCATGAGAAG GGAAGTCAAGCCTCAAGAAAGGGTATGCTGGTTGAGAAGGAAAGCATGGATACAATTG

ACCAAGCAACCCATCTTGTCGAGCAAGCCCACAACATGAGGGACAAAATCCAAG AGATCAACAGCAAGATGCTCTACTATGGAGAGAATCAGGAACTTG

GCCCCGAGGAAATAGCTGAGAAGCTGGTGTTGGCCCAGAAAATGCTGGAAGAGATCCGAAGCCGGCAGCCATTCCTCACCCATCGGGAGCTGGTGGATGA

GGAGGCAGATGAGGCCCAGGAAT TGCTGAGCCAAGCTGAGAACTGGCAGCGGCTGCACAATGACACCCGCTCTTTATTCCCCGTGGTGCTGGAGCAGCT

GGACGACTACAACGCTAAGCTGTCCGACCTCCAGGAATCCATTAACCAGGCCCTCGACCATGTCAGGGATGCAGAAGACATGAATAGAGCCATCACTTTC

AAGCAGCGGGACCATGAG AAACAACATGAGAGAGTGAAGGAACAGATGGAAGTTGTGGGTGCCTCTCTGAGTATGTCTGCAGACTCTCTTACCATACCT

CAGCTCACTCTTGAGGAACTTGATGAGATAATAAAG AATGCATCTGGAATTTATGCAGAAATAGATGGAGCCAAAAATGAGCTGCAAGGAAAACTATCC

AACCTGAGTAACCTCAGTCATGACTTGGTTCAGGAAGCTACGGACCATGCATACAATCTTCAACAGGAAGCCGATGAGCTAAGCAG AAATTTGCACAGT

TCAGACATGAACGGGCTGGTACAGAAGGCTTTGGATGCATCAAACGTCTATGAAAATATCGCCAATTATGTCAGTGAAGCCAACGAAACAGCAGAACTTG

CTCTGAATATCACTGATCGAATTTATGAT GCTGTGAGTGGGATTGACACGCAGATCATTTACCATAAGGATGAAAGTGACAACCTTCTCAATCAAGCCA

GAGAGCTGCAGGCCAAGGCAGATTCTA GCAATGATGAAGCAGTGGCTGACACCAGCAGGCGTGTGGGTGGAGCCCTGTGGAGGAAGGGCGCCCTCAGAG

ACAGACTGAATGATGCTGTTAAGCAACTACAGGCAGCAGAGAGAG GGGACGCCCACCAGCGCCTGGGCCAGTCCAAGCTCTTCATTGAGGAAGCTAACA

AGACGACAGCGGCTGTCCAACAGGTTACCACACCAATGGCTAACAACCTCAGCAACTGGTCCCAGAACCTGCAGACCTTTGACTCATCTGCATATAACAC

TGCAGTGGACTCTGCTCGGGACGCAG TGAGAAACCTCACCGAGGTTGTCCCCCAGCTTCTGGATCAGCTTCGTACTGTGGAGCAGAAGCGGCCTGCAAG

CAACATTTCTGCCAGCATCCAGAGGATCCGAGAGCTCATTGCTCAAACCAGGAGTGTCGCAAGCAAG ATCCAAGTCTCCATGATGTTTGATGGCCAGTC

AGCTGTCGAAGTGCACCCCAAAGTCAGTGTGGATGACCTGAAGGCCTTCACATCCATCAGCTTGTACATGAAGCCTCCTCCAAAGCCGGCAGAGCCCACT

GGGGCCTGGGTAGCAGATCAGTTTGTCCTCTACCTCGGAAGCAAAAAC GCCAAAAAAGAATACATGGGTCTGGCAATCAAAAATGATAACCTGGTATAC

GTTTACAATTTGGGGATGAAAGATGTGGAAATTCTCCTGGATTCCAAGCCTGTGAGCTCCTGGCCCGCTTACTTTAGTATTGTCAAGATTGAAAG GGTA

GGGAAACACGGAAAGGTGTTCTTGACAGTCCCCAGTCTCAGTAGCACAGCAGAAGAAAAGTTTATTAAGAAGGGGGAGTTTGCAGGAGATGACTCCTTGC

TGGATCTGACCCCTGAGGACACTGTGTTTTACGTTGGTGGGGTGCCTGCGAACTTCAAG CTCCCTGCCAGCTTAAACCTGCCCAGCTACTCAGGCTGCC

TAGAGCTGGCCACTCTGAATAATGATGTGATCAGCTTGTACAACTTCAAGCACATCTATAATATGGATCCATCAAAGTCAGTGCCCTGTGCCAG GGATA

AACTGGCTTTCACTCAGAGTAGGGCTGCCAGCTACTTCTTCGATGGCTCCAGTTATGCAGTGGTGAGGGACATCACGAGGAGAGGGAAGTTTGGTCAGGT

GACTCGCTTTGACATAGAAATCCGAACACCAGCTGACAATGGCCTTGTGCTCCTGATGGTCAATGGC AGTATGTTTTTCAGCCTCGAAATGCGCAATGG

CTACCTACATGTGTTCTATGACTTTGGATTCAGCAATGGCCCCGTGCATCTTGAAGACACGTTGAAAAAAGCCCAGATTAATGATGCGAAATATCATGAG

 ATCTCAATCATTTATCACAACGACAAAAAAATGATTTTGGTGGTGGACAGACGGCACGTTAAGAGCACAGACAATGAGAAGAAAAAGATTCCTTTCACG

GACATCTACATCGGAGGTGCGCCCCAAGAAGTCTTACAGTCCAG GACCCTAAGAGCACACCTTCCCCTAGATATCAACTTTAGGGGGTGCATGAAGGGG

TTCCAGTTCCAAAAGAAAGATTTCAATTTACTGGAGCAGACAGAAACCCTAGGAGTTGGTTATGGATGCCCAGAGGACTCTCTG ATATCTCGCAGAGCA

TATTTCAATGGGCAAAGTTTTATTGCTTCAATTCAGAAAATATCTTTCTTTGATGGCTTTGAAGGAGGCTTCAATTTCCGAACATTACAGCCAAATGGGT

TACTATTCTACTACACATCAGGG TCGGACGTGTTTTCCATTTCACTGGACAACGGCACTGTTGTCATGGACGTAAAGGGCATCAAGGTCATGTCAACAG

ACAAGCAGTACCACGATGGGCTGCCCCACTTCGTGGTCACCTCCATCTCAGACACAAG ATATGAACTGGTAGTAGACAAAAGCCGACTTCGAGGGAAGA

ATCCAACAAAAGGGAAGGCAGAGCAGACTCAAACAACTGAGAAGAAGTTCTACTTTGGTGGCTCACCCATCAGTCCTCAGTATGCTAATTTCACTGGATG

TATAAGCAATGCCTACTTTACCAG GTTGGATAGAGATGTGGAAGTCGAAGACTTCCAGCGCTATTCTGAAAAGGTCCACACTTCACTCTATGAGTGTCC

GATTGAGTCGTCACCTCTGTTTCTCCTTCACAAAAAAGGAAAGAATTCCTCAAAGCCTAAAACAAACAAACAG GGAGAGAAGAGTAAGGATGCGCCTTC

ATGGGATCCTATTGGCCTGAAGTTTCTGGAACAGAAAGCTCCAAGAGATTCCCACTGCCACCTCTCCAGCAGCCCCAGGGCAATAGAACATGCCTATCAA

TATGGCGGCACGGCCAACAGTCGCCAGGAGTTTGAACACGAACAAGGAGATTTTGGTGAAAA ATCCCAGTTTGCCATTCGTCTGAAGACCCGTTCCTCA

CATGGGATGATTTTCTATGTCTCAGACCAAGAAGAGAATGATTTCATGACCCTGTTCTTGGCCCATGGTCGCTTGGTCTTTATGTTTAATGTTGGCCATA

AGAAACTGAAGATTAGAAGCCAGGAGAAATACAATGATGGATTGTGGCATGAT GTGATATTTATTCGGGAAAAGAGCAGTGGTCGACTGGTCATTGATG

GTCTACGAGTCCTAGAAGAAAGGCTTCCCCCTAGTGGCGCTGCCTGGAAAATCAAGGGTCCCATTTATCTGGGAGGAGTGGCTCCCGGAAGAGCCGTGAA

AAATGTCCAG ATTACCTCCGTCTACAGCTTCAGTGGCTGCCTTGGCAATCTCCAGCTCAATGGTGCCTCCATCACCTCCGCTTCTCAAACGTTTAGCGT

GACCCCTTGCTTTGAAGGGCCAATGGAAACAGGAACTTATTTTTCCACAGAAGGCGGCTATGTGGTTCTAG ATGAGTCTTTCAATATTGGGTTAAAATT

TGAAATTGCCTTTGAAGTCCGCCCCCGGAGCAGTTCTGGAACCCTTGTCCATGGCCACAGCGTCAACGGGGAATACCTGAACGTGCACATGAGAAACGGA

CAG GTCATAGTGAAGGTCAACAACGGTGTCAGAGACTTTTCTACCTCAGTAACTCCCAAGCAGAATCTCTGTGATGGCAGATGGCACAGAATTACAG T

TATTAGAGATTCAAACGTGGTTCAGTTGGATGTAGACTCAGAAGTGAACCATGTAGTTGGGCCGTTGAATCCAAAGCCAGTTGATCACAGGGAGCCTGTG

TTTGTTGGAGGTGTTCCAG - UNI14117 - AGTCTTTACTGACACCACGTTTGGCTCCCAGCAAACCCTTCACCGGCTGCATCCGCCACTTTGTAAT

TGACAGCCGCCCTGTGAGCTTCAGTAAAGCTGCCCTGGTCAGTGGTGCTGTGAGCATCAACTCCTGTCCCACAGCCTGACACAGCTGCAAGGCTGCTGAA

GACAGCTCTTCCTAACACTGAAATAAACATAGTAGTGGGGGGTCGGGAGGGTCAGAGGCCTGGAACTCCCCTCCCTACTGAAGCTCTCACCTGGTTGAAG

GGGATTTCAATAAATCAGAGACCAGCC
Translation
MGWSTAWCSVLALWLLWCAVCSNAASGDGNAFPFDIEGSAVVGRQDPSETSDSGVTLGRLPPAAE RCDAGFFRTLSGECAPCDCNGNSHECLDGSGFCL

 HCQRNTTGEHCEKCLDGYIGDSIRGTPRFCQPCPCPLPHLAN NFAESCYRKNGAVRCICKENYVGPNCER RCAPGYYGNPLLIGSTCKKCDCSGNSD

PNLIFEDCDEITGQCRNCLRNTTGFKCERCAPGYYGDARTAKNCAV VCNCGGGPCDSVTGECLEEGFEVPTG GCDKCVWDLTDDLRLAALSIEESKSG

LLSVSSGAAAHRHVTDMNSTIHLLR TRLSERENQYTLRKIQINNSENTLRSLLPDVEGLHEK GSQASRKGMLVEKESMDTIDQATHLVEQAHNMRDKI

QE EINSKMLYYGENQELGPEEIAEKLVLAQKMLEEIRSRQPFLTHRELVDEEADEAQEL LLSQAENWQRLHNDTRSLFPVVLEQLDDYNAKLSDLQES

INQALDHVRDAEDMNRAITFKQRDHE KQHERVKEQMEVVGASLSMSADSLTIPQLTLEELDEIIK NASGIYAEIDGAKNELQGKLSNLSNLSHDLVQE

ATDHAYNLQQEADELSR RNLHSSDMNGLVQKALDASNVYENIANYVSEANETAELALNITDRIYD AVSGIDTQIIYHKDESDNLLNQARELQAKADSS

 SNDEAVADTSRRVGGALWRKGALRDRLNDAVKQLQAAERG GDAHQRLGQSKLFIEEANKTTAAVQQVTTPMANNLSNWSQNLQTFDSSAYNTAVDSAR

DAV VRNLTEVVPQLLDQLRTVEQKRPASNISASIQRIRELIAQTRSVASK IQVSMMFDGQSAVEVHPKVSVDDLKAFTSISLYMKPPPKPAEPTGAWV

ADQFVLYLGSKN AKKEYMGLAIKNDNLVYVYNLGMKDVEILLDSKPVSSWPAYFSIVKIER RVGKHGKVFLTVPSLSSTAEEKFIKKGEFAGDDSLLD

LTPEDTVFYVGGVPANFK LPASLNLPSYSGCLELATLNNDVISLYNFKHIYNMDPSKSVPCAR RDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQ

VTRFDIEIRTPADNGLVLLMVNG SMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHE ISIIYHNDKKMILVVDRRHVKSTDNEKKKIP

FTDIYIGGAPQEVLQSR RTLRAHLPLDINFRGCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSL ISRRAYFNGQSFIASIQKISFFDGFEGGFNFRTL

QPNGLLFYYTSG SDVFSISLDNGTVVMDVKGIKVMSTDKQYHDGLPHFVVTSISDTR RYELVVDKSRLRGKNPTKGKAEQTQTTEKKFYFGGSPISPQ

YANFTGCISNAYFTR RLDRDVEVEDFQRYSEKVHTSLYECPIESSPLFLLHKKGKNSSKPKTNKQ GEKSKDAPSWDPIGLKFLEQKAPRDSHCHLSSS

PRAIEHAYQYGGTANSRQEFEHEQGDFGEK KSQFAIRLKTRSSHGMIFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHD VIFI

REKSSGRLVIDGLRVLEERLPPSGAAWKIKGPIYLGGVAPGRAVKNVQ ITSVYSFSGCLGNLQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYV

VLD DESFNIGLKFEIAFEVRPRSSSGTLVHGHSVNGEYLNVHMRNGQ VIVKVNNGVRDFSTSVTPKQNLCDGRWHRITV VIRDSNVVQLDVDSEVNH

VVGPLNPKPVDHREPVFVGGVPE - UNI14117 - ESLLTPRLAPSKPFTGCIRHFVIDSRPVSFSKAALVSGAVSINSCPTA

For any suggestions or comments, please send an email to unitrap@crg.es