Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019861 (Gopc)
Chromosomal location
Chr 10: 52056891 - 52101881 (-)
Description
golgi associated PDZ and coiled-coil motif containing Gene [Source:MGI Symbol;Acc:MGI:2149946]
RefSeq_dna
NM_053187 
RefSeq_peptide
NP_444417.2 
UniGene
Mm.396961 
MGI
MGI:2149946 
Uniprot/SWISSPROT
Q8BH60 
Human Ortholog
ENSG00000047932 (GOPC)
Omim not available
UniTrap UNI20838
Vector Insertion
Chr 10: 52059660 - 52065854
Public Clones not available
Private Clones OST350481 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020008
Sequence
CGCTGCCGGCGTTGGCGGCGCGAGGGAAGGGAGGGGACCGGCGGGTGTGTGTCTGTGTGTGTGTGCGTGTGTGTCTGTGTGTGCGCGCGCGCGGGGGGCG

CCGCGGTGCTAGCAGTTCCCCTCGCGCGGGGCGGGCGGCCAGAGTGAGCAGCAGTCGGCGAGGCCCTGGACGGCGCCATGTCGGCGGGTGGCCCATGCCC

GGCGGGAGCCGGCGGCGGCCCAGGGGGCTCCTCCTGCCCTGTGGGGGTCTCCCCTGGCGGGGTGTCCATGTTCCGATGGCTTGAGGTGCTGGAGAAGGAG

TTCGACAAGGCCTTCGTGGATGTGGATCTGCTTTTGGGCGAGATCGATCCGGACCAGGCGGACATCACTTATGAGGGGCGTCAGAAGATGACCAGCCTTA

GCTCCTGCTTTGCGCAGCTATGCCACAAAGCCCAGACTGTGTCCCAGATCAACCACAAGCTTGAG GCACAGTTGGTGGATCTGCGATCGGAATTGACAG

AGACTCAAGCAGAGAAAGTTGTTCTGGAGAAAGAAGTCCACGAGCAGCTTTTACAGCTGCACTCCACTCAGCTTCAGCTTCATGCCAAGACTGGTCAAAG

TGTTGACTCTGGGGCCATCAAGGCAAAATTG GAAAGAGAACTTGAAGCAAATAAAACAGAAAAGGTAAAAGAAGCTCGACTTGAAGCTGAAGTGAAGCT

ACTAAGGAAGGAGAACGAGGCTCTTCGAAGGCACATAGCTGTTCTCCAGGCTGAAGTTTATGGGGCGAGGTTGGCTGCCAAGTACTTGGATAAGGAGCTG

GCCGGCAG GGTGCAACAGATACAATTACTGGGACGGGATATGAAGGGACCTGCTCACGATAAGCTCTGGAACCAGTTAGAAGCTGAAATACATTTGCAT

CGCCACAAAACTGTCATCAGAGCCTGCAGAGGGCGCAACGACTTGAAGCGGCCCATGCAAGCACCCCCAGGCCAC GATCAAGACTCTTTGAAGAAAAGC

CAGGGAGTCGGTCCAATTAGAAAAGTTCTCCTCCTTAAGGAAGACCATGAAGGCCTGGGCATTTCTATCACA GGTGGGAAAGAGCACGGTGTTCCCATC

CTCATCTCTGAGATCCACCCGGGACAGCCTGCGGATAGATGTGGAGGGCTGCATGTTGGAGATGCTATTCTGGCAGTCAATGGAGTCAACCTAAGAGACA

CAAAGCATAAAGAAGCTGTAACTATACTCTCCCAGCAG AGAGGAGAGATTGAGTTTGAAGTAGTCTACGTGGCACCTGAAGTGGATTCTGACGATGAAA

ATGTAGAGTATGAAGACGAGAGTGGACACCGCTATCGTCTGTATCTTGACGAGTTAGAAGGCAGTGGGAATTCTGGTGCTAGTTGCAAAGACAGCAGTGG

CGAGATGAAAATGTTACAAG - UNI20838 - GGTATAACAAGAAGGCAGTGAGGGATGCGCATGAGAATGGGGACGTGGGGGCTGCAGGTGAGAGCC

CTCTGGATGACACTGCTGCGAGAGCGGCTCATCTGCACAGCCTGCATCAGAAGAAGGCCTACTAACCCAGACACGCTGCTTGTCAGACTCGTGGAGTGTG

GGGCACTAGAGAAGACGGTGACAAAGACTGCACAAGATCAGGGAGGCTGTGTGTTGCCTAGAGAAAGGCGGGAACCTCAGGGCTTCATGTGAACAATTCT

AAGTGCATAAACCCCTGTTTTCTGTGGTATACCTTAATTAGCTATTGCATGGAAGGCAGTTTTGATTTTCCTGGAATCTAAGCACCAAAGCATGTGTTTC

CCAAAGGGGTTTTACTAGGCTCTTACAGGCCAAGTGGATGCTATTTCATTTGGCTCCTTTTCATGTATAACAGGACAGTGCTAACTGGAATTCTCTAAGT

ACCCTTTAAATACAGCAGAGTAAATGATACCATATATTCCCTAAGGATAACTGCGGAATTTCAGATGACAGAACTTTACTCAGTGAATTGCAAAAATCTA

GGTTGACATTTTTGCTTAATTGAAAATTTTGTTTCAGGTTTTTTTTAAAAAGTATCTTGTACATTCCTGATATCTAAATTAATTACTATCTTAAATCATT

ATGATGAGTTCACTCTCCAGGTAACTCAACTGCAGTACAAAACGGTTTTCTTTAGGCAATCCTGTATCAATCAATGCTGCTCTAGGAATAGTTTGGGAAA

AGTTACTGTGCATTTGACTTTGGACTTTTAAAGGAAACGCAGACAAGTGGAAAATGGCCTGTTTTCAATTATGTTGATCTGTGTGCATGGTATTGGAGCA

TTACACTGTTAATGTTTAGTCCCAAATGTTAATTGTCTGGAATCCACGAAAAACAGCTTTATACATTTTTGAGCTGTTCCCAAGCTTTGTCTTGTGATAG

TCAGGAACATTACTATGTCATGAAATACATTGTGTTCAAACAGCAGTTGGCTTTAAGTACCTGACTTGCCAGTCATTTAAAAAGCCGGGGGCCAAGGTAG

GCAAGATGAGGTAAAGACATTTTGGTACAGTGAGCATATTGGTTTTTATATCAGTATATGTTTGACTAAAGCAATACTCGTGTGCAAACTCTGTAAATGT

ATTAGTTCTATTGTATCAGAACTAAGTACAGAGTGCCTGCTCCCTTCTTTCCTGACCTACAGACAATTGCACCCTGCCTGCCGGGCAAACTGAAAATACT

GTACTTAAAGAGGTGTGATTTTTGCTAAGTCACTGTTTTAAAGGATTTACACCTAAGGGAATCTTATGTGGGAGAAGCCTACATATATCGGGCTTTTACA

ATATCAGTATCTTCTTTCTTGGTATGCTTGTTTTTCCCAGATGCATTATATATTTGTTCAAAGTTAAAATCTATAAAATGTATATACTTTATTTTGTGAT

TTTGCTATTTATAAATTTTCTTTTTAACTGTTGCTCATTTATGGTCTCTGGGTGGTTTCGTTCTTCATAGTATCACCATGTTAACTGGTAACTGAAAGTG

CACTTCGTATGTATATTGTTAGTGATGCTGAGATACCTTGTAGTGTAACATTGCCTGTAAACAAGGTTAGTATTTTAACTGTACAAATGAATAAACACGT

TACATATTACTGTTTGCTCCTGATAGGCTAGACCTCTTAAAAGAAAGATTGTTTTTTCCTCAAGTATTCCTCCCACACCAAACACATACCCCAGTGCATG

ACTTGAGACCTTCAAAGTAGGTGGTAGCCATTGTATTCATTTAAGGAAAAAATGTTCATGGTAACAGATCTGAAATATTTTTGCTTTGACCTGAAACCAT

GCTGCTCCTATATCCTTTCAGCATTGCCTGGGAAGGACCAGGGCCATTTTATTTTCCTTTTTATTCATAGATTATATGCCTTATATACTATGATTGAATC

GCTAGGAAATGTAAGCTATATAACCCTTTGAATTTTTTCAAGAACTTCACAGCAGATGTGAAAGCAAAACTTGGATGAGCATTTTCATGTGCTGCCTAGG

AGGGATTGTGTGAGATGGGTACAGAATATATTTAGAAAGAGTAGTTTATGGTTCTACAGGTCCGTCTTTCCATCTCTGCTTTCTGGTTTGGAAGCATAGG

AGAGTGCTGTGGCGTGAAACCTGCTCTGAGAGCATCCTGGTACTCTCCCAGGCCCACTGGAGAGTTCACTTCAGAGTGTGTGGTCCCAAAGCACTAAGTG

AAAAGTAGTCTTTATAGTTCATGTTCATAGGAAAGATGCCCATATAACACTGACTCTTCTTGAACAAAGCCAAAAAATGGGGGGAAAGCTGTTGCAAAGC

CATTACAATGAAAACGTGTAGAGCATGAGAGGTGTGTGCGTGGACATACTCACACTTATTGTGTGAAATTGTCTTCTGCAGTTTTCTGTTCTGAACATGA

TGAAAGTGACGTATTCGGGTTAGGGATTATTGTTAAATTAAATTTGAGAGAGATGAAGAGCTTGCAAGTCTGTTGATTAGAATTAAACAATTACAAATAA

CATAACCTGTCCATGGTGCTGGAATAGACCCCACAGCAAGGGGCTTATGTTGTTTTCATATTTTAAAACAAAAAATATATTAATTTACATATAAGGGGAT

TTATGATAATTGTATTATATCTAGTTGAGTTTCATATTCTTAATTAGCCTGTAAATAAAAATGACATATTCTACATTAAAGCAGTATTGATCAGATTTGA

AGG
Translation
MSAGGPCPAGAGGGPGGSSCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLE AQL

VDLRSELTETQAEKVVLEKEVHEQLLQLHSTQLQLHAKTGQSVDSGAIKAKL ERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVLQAEVYGARL

AAKYLDKELAGR RVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGH DQDSLKKSQGVGPIRKVLLLKEDHEGLGIS

IT GGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ RGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEG

SGNSGASCKDSSGEMKMLQG - UNI20838 - GYNKKAVRDAHENGDVGAAGESPLDDTAARAAHLHSLHQKKAY
Transcript ENSMUST00000105475
Sequence
CGCTGCCGGCGTTGGCGGCGCGAGGGAAGGGAGGGGACCGGCGGGTGTGTGTCTGTGTGTGTGTGCGTGTGTGTCTGTGTGTGCGCGCGCGCGGGGGGCG

CCGCGGTGCTAGCAGTTCCCCTCGCGCGGGGCGGGCGGCCAGAGTGAGCAGCAGTCGGCGAGGCCCTGGACGGCGCCATGTCGGCGGGTGGCCCATGCCC

GGCGGGAGCCGGCGGCGGCCCAGGGGGCTCCTCCTGCCCTGTGGGGGTCTCCCCTGGCGGGGTGTCCATGTTCCGATGGCTTGAGGTGCTGGAGAAGGAG

TTCGACAAGGCCTTCGTGGATGTGGATCTGCTTTTGGGCGAGATCGATCCGGACCAGGCGGACATCACTTATGAGGGGCGTCAGAAGATGACCAGCCTTA

GCTCCTGCTTTGCGCAGCTATGCCACAAAGCCCAGACTGTGTCCCAGATCAACCACAAGCTTGAG GCACAGTTGGTGGATCTGCGATCGGAATTGACAG

AGACTCAAGCAGAGAAAGTTGTTCTGGAGAAAGAAGTCCACGAGCAGCTTTTACAGCTGCACTCCACTCAGCTTCAGCTTCATGCCAAGACTGGTCAAAG

TGTTGACTCTGGGGCCATCAAGGCAAAATTG TCTGTCCACTCTGTGGAGGATCTG GAAAGAGAACTTGAAGCAAATAAAACAGAAAAGGTAAAAGAAG

CTCGACTTGAAGCTGAAGTGAAGCTACTAAGGAAGGAGAACGAGGCTCTTCGAAGGCACATAGCTGTTCTCCAGGCTGAAGTTTATGGGGCGAGGTTGGC

TGCCAAGTACTTGGATAAGGAGCTGGCCGGCAG GGTGCAACAGATACAATTACTGGGACGGGATATGAAGGGACCTGCTCACGATAAGCTCTGGAACCA

GTTAGAAGCTGAAATACATTTGCATCGCCACAAAACTGTCATCAGAGCCTGCAGAGGGCGCAACGACTTGAAGCGGCCCATGCAAGCACCCCCAGGCCAC

 GATCAAGACTCTTTGAAGAAAAGCCAGGGAGTCGGTCCAATTAGAAAAGTTCTCCTCCTTAAGGAAGACCATGAAGGCCTGGGCATTTCTATCACA GG

TGGGAAAGAGCACGGTGTTCCCATCCTCATCTCTGAGATCCACCCGGGACAGCCTGCGGATAGATGTGGAGGGCTGCATGTTGGAGATGCTATTCTGGCA

GTCAATGGAGTCAACCTAAGAGACACAAAGCATAAAGAAGCTGTAACTATACTCTCCCAGCAG AGAGGAGAGATTGAGTTTGAAGTAGTCTACGTGGCA

CCTGAAGTGGATTCTGACGATGAAAATGTAGAGTATGAAGACGAGAGTGGACACCGCTATCGTCTGTATCTTGACGAGTTAGAAGGCAGTGGGAATTCTG

GTGCTAGTTGCAAAGACAGCAGTGGCGAGATGAAAATGTTACAAG - UNI20838 - GGTATAACAAGAAGGCAGTGAGGGATGCGCATGAGAATGGG

GACGTGGGGGCTGCAGGTGAGAGCCCTCTGGATGACACTGCTGCGAGAGCGGCTCATCTGCACAGCCTGCATCAGAAGAAGGCCTACTAACCCAGACACG

CTGCTTGTCAGACTCGTGGAGTGTGGGGCACTAGAGAAGACGGTGACAAAGACTGCACAAGATCAGGGAGGCTGTGTGTTGCCTAGAGAAAGGCGGGAAC

CTCAGGGCTTCATGTGAACAATTCTAAGTGCATAAACCCCTGTTTTCTGTGGTATACCTTAATTAGCTATTGCATGGAAGGCAGTTTTGATTTTCCTGGA

ATCTAAGCACCAAAGCATGTGTTTCCCAAAGGGGTTTTACTAGGCTCTTACAGGCCAAGTGGATGCTATTTCATTTGGCTCCTTTTCATGTATAACAGGA

CAGTGCTAACTGGAATTCTCTAAGTACCCTTTAAATACAGCAGAGTAAATGATACCATATATTCCCTAAGGATAACTGCGGAATTTCAGATGACAGAACT

TTACTCAGTGAATTGCAAAAATCTAGGTTGACATTTTTGCTTAATTGAAAATTTTGTTTCAGGTTTTTTTTAAAAAGTATCTTGTACATTCCTGATATCT

AAATTAATTACTATCTTAAATCATTATGATGAGTTCACTCTCCAGGTAACTCAACTGCAGTACAAAACGGTTTTCTTTAGGCAATCCTGTATCAATCAAT

GCTGCTCTAGGAATAGTTTGGGAAAAGTTACTGTGCATTTGACTTTGGACTTTTAAAGGAAACGCAGACAAGTGGAAAATGGCCTGTTTTCAATTATGTT

GATCTGTGTGCATGGTATTGGAGCATTACACTGTTAATGTTTAGTCCCAAATGTTAATTGTCTGGAATCCACGAAAAACAGCTTTATACATTTTTGAGCT

GTTCCCAAGCTTTGTCTTGTGATAGTCAGGAACATTACTATGTCATGAAATACATTGTGTTCAAACAGCAGTTGGCTTTAAGTACCTGACTTGCCAGTCA

TTTAAAAAGCCGGGGGCCAAGGTAGGCAAGATGAGGTAAAGACATTTTGGTACAGTGAGCATATTGGTTTTTATATCAGTATATGTTTGACTAAAGCAAT

ACTCGTGTGCAAACTCTGTAAATGTATTAGTTCTATTGTATCAGAACTAAGTACAGAGTGCCTGCTCCCTTCTTTCCTGACCTACAGACAATTGCACCCT

GCCTGCCGGGCAAACTGAAAATACTGTACTTAAAGAGGTGTGATTTTTGCTAAGTCACTGTTTTAAAGGATTTACACCTAAGGGAATCTTATGTGGGAGA

AGCCTACATATATCGGGCTTTTACAATATCAGTATCTTCTTTCTTGGTATGCTTGTTTTTCCCAGATGCATTATATATTTGTTCAAAGTTAAAATCTATA

AAATGTATATACTTTATTTTGTGATTTTGCTATTTATAAATTTTCTTTTTAACTGTTGCTCATTTATGGTCTCTGGGTGGTTTCGTTCTTCATAGTATCA

CCATGTTAACTGGTAACTGAAAGTGCACTTCGTATGTATATTGTTAGTGATGCTGAGATACCTTGTAGTGTAACATTGCCTGTAAACAAGGTTAGTATTT

TAACTGTACAAATGAATAAACACGTTACATATTACTGTTTGCTCCTGATAGGCTAGACCTCTTAAAAGAAAGATTGTTTTTTCCTCAAGTATTCCTCCCA

CACCAAACACATACCCCAGTGCATGACTTGAGACCTTCAAAGTAGGTGGTAGCCATTGTATTCATTTAAGGAAAAAATGTTCATGGTAACAGATCTGAAA

TATTTTTGCTTTGACCTGAAACCATGCTGCTCCTATATCCTTTCAGCATTGCCTGGGAAGGACCAGGGCCATTTTATTTTCCTTTTTATTCATAGATTAT

ATGCCTTATATACTATGATTGAATCGCTAGGAAATGTAAGCTATATAACCCTTTGAATTTTTTCAAGAACTTCACAGCAGATGTGAAAGCAAAACTTGGA

TGAGCATTTTCATGTGCTGCCTAGGAGGGATTGTGTGAGATGGGTACAGAATATATTTAGAAAGAGTAGTTTATGGTTCTACAGGTCCGTCTTTCCATCT

CTGCTTTCTGGTTTGGAAGCATAGGAGAGTGCTGTGGCGTGAAACCTGCTCTGAGAGCATCCTGGTACTCTCCCAGGCCCACTGGAGAGTTCACTTCAGA

GTGTGTGGTCCCAAAGCACTAAGTGAAAAGTAGTCTTTATAGTTCATGTTCATAGGAAAGATGCCCATATAACACTGACTCTTCTTGAACAAAGCCAAAA

AATGGGGGGAAAGCTGTTGCAAAGCCATTACAATGAAAACGTGTAGAGCATGAGAGGTGTGTGCGTGGACATACTCACACTTATTGTGTGAAATTGTCTT

CTGCAGTTTTCTGTTCTGAACATGATGAAAGTGACGTATTCGGGTTAGGGATTATTGTTAAATTAAATTTGAGAGAGATGAAGAGCTTGCAAGTCTGTTG

ATTAGAATTAAACAATTACAAATAACATAACCTGTCCATGGTGCTGGAATAGACCCCACAGCAAGGGGCTTATGTTGTTTTCATATTTTAAAACAAAAAA

TATATTAATTTACATATAAGGGGATTTATGATAATTGTATTATATCTAGTTGAGTTTCATATTCTTAATTAGCCTGTAAATAAAAATGACATATTCTACA

TTAAAGCAGTATTGATCAGATTTGAAGG
Translation
MSAGGPCPAGAGGGPGGSSCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLE AQL

VDLRSELTETQAEKVVLEKEVHEQLLQLHSTQLQLHAKTGQSVDSGAIKAKL SVHSVEDL ERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVL

QAEVYGARLAAKYLDKELAGR RVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGH DQDSLKKSQGVGPIRKVLLLK

EDHEGLGISIT GGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ RGEIEFEVVYVAPEVDSDDENVEYEDESGHRY

RLYLDELEGSGNSGASCKDSSGEMKMLQG - UNI20838 - GYNKKAVRDAHENGDVGAAGESPLDDTAARAAHLHSLHQKKAY

For any suggestions or comments, please send an email to unitrap@crg.es