Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019878 (Hsf2)
Chromosomal location
Chr 10: 57206292 - 57232941 (+)
Description
heat shock factor 2 Gene [Source:MGI Symbol;Acc:MGI:96239]
RefSeq_dna
NM_008297 
RefSeq_peptide
NP_032323.2 
UniGene
Mm.261395 Mm.393422 
MGI
MGI:96239 
Uniprot/SWISSPROT
P38533 
Uniprot/SPTREMBL
Q8BWK6 
Human Ortholog
ENSG00000025156 (HSF2)
Omim not available
UniTrap UNI37662
Vector Insertion
Chr 10: 57215813 - 57215960
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2325
Vector Insertion
Chr 10: 57219298 - 57221175
Public Clones AE0204 (sanger) AP0649 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4103
Vector Insertion
Chr 10: 57224537 - 57224951
Public Clones AN0715 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079833
Sequence
GGAATCCCTGCACCGGGCTAACAATGAAGCAGAGTTCCAACGTGCCGGCTTTCCTCAGCAAGCTGTGGACGCTTGTGGAGGAAACCCACACCAACGAGTT

CATCACCTGGAGTCAG AATGGACAAAGTTTTCTGGTCTTGGATGAGCAAAGATTTGCAAAGGAAATTCTTCCTAAGTACTTCAAACACAATAACATGGC

GAGCTTTGTGAGACAACTAAATATGT ATGGCTTCCGAAAAGTAGTGCATATCGAATCTGGAATTATCAAACAGGAAAGAGATGGCCCTGTTGAATTTCA

GCATCCTTATTTCAAGCAAGGCCAGGATGACCTGTTGGAGAACATTAAAAGGAAG GTTTCATCTTCAAAACCAGAGGAAAATAAAATTCGTCAGGAAGA

TTTAACAAAAATTATTAGTAGTGCTCAGAAGGTTCAAATAAAACAAGAAACTATTGAGTCCAGGCTTTCAGAATTAAAAAG TGAGAATGAATCCCTTTG

GAAGGAGGTGTCAGAACTAAGAGCAAAGCATGCCCAGCAGCAACAAGTTATTCGGAAG - UNI2325 - ATTGTCCAGTTTATTGTTACATTGGTTCA

GAATAATCAACTTGTGAGTTTAAAACGTAAAAG GCCTCTACTTCTAAACACAAATGGAGCCCCAAAGAAGAATCTATATCAGCACATAGTCAAAGAACC

AACTGATAATCACCATCATAAA GTTCCACACAGCAGGACTGAAGGTTTAAAGTCAAGAGAACGGATTTCAGATGACATAATTATTTATGATGTTACTGA

CGATAATGTGGATGAAGAAAATATTCCAGTTATTCCAGAAACAAATGAGGATGTTGTAGTGGATTCCTCCAA - UNI4103 - CCAGTATCCTGACAT

TGTCATTGTTGAAGATGACAACGAGGATGAGTATGCTCCTGTCATTCAGAGTGGAGAGCAGAGTGAACCAGCCAGAGAACCCTTACGTGTGGGGAGTGCT

GGCAGCAGCAGCCCTCTCATGTCTAGTGCTGTCCAGCTAAACGGCTCCTCCAGTCTGACCTCAGAAGACCCTGTGACCATGATGGACTCCATTCTGAATG

ACAACATTAACCTGTTAGGAAA GGTTGAGCTGTTGGATTACCTTGACAGTATTGATTGCAGTTTAGAGGACTTCCAAGCTATGCTCTCAGGAAGACAGT

TTAGCATAGACCCAGATCTTCTGGTTGAT TCTGAGAATAAGGGACTAGAAGCTACCAAGAGCAGTGTTGTTCAACATGTGTCAGAAGAGGGAAGAAAAT

CTAAATCCAAGCCAG ACAAACAACTTATCCAGTATACTGCCTTTCCACTTCTTGCATTCCTGGATGGGAACTCTGCATCTGCTATTGAACAGGGGAGTA

CAACTGCATCGTCAGAAGTTGTGCCTTCTGTAGATAAACCCATAGAAGTCGATGAGCTCCTGGATAGCAGCCTGGATCCAGAACCGACCCAGAGTAAGCT

TGTCCGCCTGGAACCATTGACTGAAGCGGAAGCTAGTGAAGCCACACTCTTCTATTTATGTGAACTTGCTCCTGCACCTCTGGATAGTGATATGCCGCTT

TTAGATAGTTAAACTCCCAAGTGGACACTGTATATATTCATCAAAATGATGAAGTATTTATTTTAAAGTATCATTTGGTACTTTGTTCTGTAAATTACTT

TTTGTTTAATCCGATACTGTGGAATCAAAGCACCTTTTGCTTTTCTCACTAACCATACTCTCACATAGCTTTCAGATGCTACTCGACTGCCTAGGCATAT

ACGTTTTAATGCACATTACTGGCATATCTTAAGTTCAATTCAAATGGCCATTTTCTCCAGTTGTAATTGGATTTTTTTTTTTTTTTTTTTTTTTTTTTTT

ACAAATATGACCATTAATCCCAGCTAAACTTGTTTATTTTCAATTGAGTTTAAGTGTCTAGAACTAAAGTAGAAAACTCTGGCCCAGTTACTTTTATTAA

ATATTTTTCACTTGGCTTATTTCTAAAACTGGGAACATAAAGTGCCTGTATCTTGTAATATTTCATGTCTTTGTTGGTTCAGAGAAATTTATTCCTGTTA

GCAGAAACGGCAAAGTGTACACGAGTACTCAGTCACTGATGTGGTACTAGCTCCAGATACATAGAGAATGTGGAGACCGGGTGTGCTTAGCCCCACCCAT

TTAGACTAGTTTAAGTATGTTTTCTGGTTTTTGTTCTTTTGAACCATGGTATTTAGTAAAATAAATATGATGGATGTCGAGTACTATTGTTTGTTGAGTC

GTCTTTGGAAGTGATCCCACATGAAGTGGTTTTTCCTTCTCATAGGAAGAAGGTGGCTTTAAATTGTGTTGTCCATTATCACACTGTGAGTCACATCAGG

GTCTTTGTGCTTTACCTGGGAGGGGCGGGGGGAGACTGTGTATTGCAGTATGGGAGGAATATGATGCTTCTGACCTTAATGTGTTTTAATGTTCTTTGTT

TAAAAAGTATACTGGCTTGCTTTCTATGTTTCTAATAAAGAACCAAGAG
Translation
MKQSSNVPAFLSKLWTLVEETHTNEFITWSQ NGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMY YGFRKVVHIESGIIKQERDGPVEFQHPYFK

QGQDDLLENIKRK VSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKS SENESLWKEVSELRAKHAQQQQVIRK - UNI2325 - IVQF

IVTLVQNNQLVSLKRKR RPLLLNTNGAPKKNLYQHIVKEPTDNHHHK VPHSRTEGLKSRERISDDIIIYDVTDDNVDEENIPVIPETNEDVVVDSSN 

- UNI4103 - NQYPDIVIVEDDNEDEYAPVIQSGEQSEPAREPLRVGSAGSSSPLMSSAVQLNGSSSLTSEDPVTMMDSILNDNINLLGK KVELLDY

LDSIDCSLEDFQAMLSGRQFSIDPDLLVD SENKGLEATKSSVVQHVSEEGRKSKSKPD DKQLIQYTAFPLLAFLDGNSASAIEQGSTTASSEVVPSVD

KPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS
Transcript ENSMUST00000081139
Sequence
GGAATCCCTGCACCGGGCTAACAATGAAGCAGAGTTCCAACGTGCCGGCTTTCCTCAGCAAGCTGTGGACGCTTGTGGAGGAAACCCACACCAACGAGTT

CATCACCTGGAGTCAG AATGGACAAAGTTTTCTGGTCTTGGATGAGCAAAGATTTGCAAAGGAAATTCTTCCTAAGTACTTCAAACACAATAACATGGC

GAGCTTTGTGAGACAACTAAATATGT ATGGCTTCCGAAAAGTAGTGCATATCGAATCTGGAATTATCAAACAGGAAAGAGATGGCCCTGTTGAATTTCA

GCATCCTTATTTCAAGCAAGGCCAGGATGACCTGTTGGAGAACATTAAAAGGAAG GTTTCATCTTCAAAACCAGAGGAAAATAAAATTCGTCAGGAAGA

TTTAACAAAAATTATTAGTAGTGCTCAGAAGGTTCAAATAAAACAAGAAACTATTGAGTCCAGGCTTTCAGAATTAAAAAG TGAGAATGAATCCCTTTG

GAAGGAGGTGTCAGAACTAAGAGCAAAGCATGCCCAGCAGCAACAAGTTATTCGGAAG - UNI2325 - ATTGTCCAGTTTATTGTTACATTGGTTCA

GAATAATCAACTTGTGAGTTTAAAACGTAAAAG GCCTCTACTTCTAAACACAAATGGAGCCCCAAAGAAGAATCTATATCAGCACATAGTCAAAGAACC

AACTGATAATCACCATCATAAA GTTCCACACAGCAGGACTGAAGGTTTAAAGTCAAGAGAACGGATTTCAGATGACATAATTATTTATGATGTTACTGA

CGATAATGTGGATGAAGAAAATATTCCAGTTATTCCAGAAACAAATGAGGATGTTGTAGTGGATTCCTCCAA - UNI4103 - CCAGTATCCTGACAT

TGTCATTGTTGAAGATGACAACGAGGATGAGTATGCTCCTGTCATTCAGAGTGGAGAGCAGAGTGAACCAGCCAGAGAACCCTTACGTGTGGGGAGTGCT

GGCAGCAGCAGCCCTCTCATGTCTAGTGCTGTCCAGCTAAACGGCTCCTCCAGTCTGACCTCAGAAGACCCTGTGACCATGATGGACTCCATTCTGAATG

ACAACATTAACCTGTTAGGAAA GGTTGAGCTGTTGGATTACCTTGACAGTATTGATTGCAGTTTAGAGGACTTCCAAGCTATGCTCTCAGGAAGACAGT

TTAGCATAGACCCAGATCTTCTGGTTGAT CTTTTCACTAGTTCTGTGCAGATGAATCCCACAGATAACATCAATAATACAAAA TCTGAGAATAAGGGA

CTAGAAGCTACCAAGAGCAGTGTTGTTCAACATGTGTCAGAAGAGGGAAGAAAATCTAAATCCAAGCCAG ACAAACAACTTATCCAGTATACTGCCTTT

CCACTTCTTGCATTCCTGGATGGGAACTCTGCATCTGCTATTGAACAGGGGAGTACAACTGCATCGTCAGAAGTTGTGCCTTCTGTAGATAAACCCATAG

AAGTCGATGAGCTCCTGGATAGCAGCCTGGATCCAGAACCGACCCAGAGTAAGCTTGTCCGCCTGGAACCATTGACTGAAGCGGAAGCTAGTGAAGCCAC

ACTCTTCTATTTATGTGAACTTGCTCCTGCACCTCTGGATAGTGATATGCCGCTTTTAGATAGTTAAACTCCCAAGTGGACACTGTATATATTCATCAAA

ATGATGAAGTATTTATTTTAAAGTATCATTTGGTACTTTGTTCTGTAAATTACTTTTTGTTTAATCCGATACTGTGGAATCAAAGCACCTTTTGCTTTTC

TCACTAACCATACTCTCACATAGCTTTCAGATGCTACTCGACTGCCTAGGCATATACGTTTTAATGCACATTACTGGCATATCTTAAGTTCAATTCAAAT

GGCCATTTTCTCCAGTTGTAATTGGATTTTTTTTTTTTTTTTTTTTTTTTTTTTTACAAATATGACCATTAATCCCAGCTAAACTTGTTTATTTTCAATT

GAGTTTAAGTGTCTAGAACTAAAGTAGAAAACTCTGGCCCAGTTACTTTTATTAAATATTTTTCACTTGGCTTATTTCTAAAACTGGGAACATAAAGTGC

CTGTATCTTGTAATATTTCATGTCTTTGTTGGTTCAGAGAAATTTATTCCTGTTAGCAGAAACGGCAAAGTGTACACGAGTACTCAGTCACTGATGTGGT

ACTAGCTCCAGATACATAGAGAATGTGGAGACCGGGTGTGCTTAGCCCCACCCATTTAGACTAGTTTAAGTATGTTTTCTGGTTTTTGTTCTTTTGAACC

ATGGTATTTAGTAAAATAAATATGATGGATGTCGAGTACTATTGTTTGTTGAGTCGTCTTTGGAAGTGATCCCACATGAAGTGGTTTTTCCTTCTCATAG

GAAGAAGGTGGCTTTAAATTGTGTTGTCCATTATCACACTGTGAGTCACATCAGGGTCTTTGTGCTTTACCTGGGAGGGGCGGGGGGAGACTGTGTATTG

CAGTATGGGAGGAATATGATGCTTCTGACCTTAATGTGTTTTAATGTTCTTTGTTTAAAAAGTATACTGGCTTGCTTTCTATGTTTCTAATAAAGAACCA

AGAG
Translation
MKQSSNVPAFLSKLWTLVEETHTNEFITWSQ NGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMY YGFRKVVHIESGIIKQERDGPVEFQHPYFK

QGQDDLLENIKRK VSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKS SENESLWKEVSELRAKHAQQQQVIRK - UNI2325 - IVQF

IVTLVQNNQLVSLKRKR RPLLLNTNGAPKKNLYQHIVKEPTDNHHHK VPHSRTEGLKSRERISDDIIIYDVTDDNVDEENIPVIPETNEDVVVDSSN 

- UNI4103 - NQYPDIVIVEDDNEDEYAPVIQSGEQSEPAREPLRVGSAGSSSPLMSSAVQLNGSSSLTSEDPVTMMDSILNDNINLLGK KVELLDY

LDSIDCSLEDFQAMLSGRQFSIDPDLLVD LFTSSVQMNPTDNINNTK SENKGLEATKSSVVQHVSEEGRKSKSKPD DKQLIQYTAFPLLAFLDGNSA

SAIEQGSTTASSEVVPSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS

For any suggestions or comments, please send an email to unitrap@crg.es