Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019889 (Ptprk)
Chromosomal location
Chr 10: 27794626 - 28316046 (+)
Description
protein tyrosine phosphatase, receptor type, K Gene [Source:MGI Symbol;Acc:MGI:103310]
RefSeq_dna
NM_008983 
RefSeq_peptide
NP_033009.1 
UniGene
Mm.332303 
MGI
MGI:103310 
Uniprot/SWISSPROT
P35822 
Uniprot/SPTREMBL
B2RRF0 Q8C462 Q8C5G0 Q8C819 Q99KV5 
Human Ortholog
ENSG00000152894 (PTPRK)
Omim not available
UniTrap UNI8149
Vector Insertion
Chr 10: 27794984 - 27925939
Public Clones (sanger) RRG435 (baygenomics) G018E04 (ggtc) CMHD-GT_252B10-3 (cmhd) FHCRC-GT-S1-1C1 (fhcrc)
FHCRC-GT-S15-11G1 (fhcrc) FHCRC-GT-S7-7F1 (fhcrc) IST12016C6 (tigm)
IST11226F6 (tigm) IST14722G1 (tigm) IST14744G3 (tigm) IST14744G4 (tigm)
IST11641B3 (tigm) IST11669B3 (tigm)
Private Clones OST55699 (lexicon) OST48930 (lexicon) OST38947 (lexicon) OST38064 (lexicon)
OST34607 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10135
Vector Insertion
Chr 10: 27926063 - 27983306
Public Clones KST236 (baygenomics) XST132 (baygenomics) KST228 (baygenomics) IST13533C5 (tigm)
IST13191F11 (tigm) IST14601E9 (tigm) IST12482F10 (tigm) IST11430B3 (tigm)
IST10886H6 (tigm) IST11430D8 (tigm) IST11640B4 (tigm) IST14869D1 (tigm)
IST14522F10 (tigm) IST11512A4 (tigm) IST13719B10 (tigm)
Private Clones OST395919 (lexicon) OST365755 (lexicon) OST56842 (lexicon) OST56315 (lexicon)
OST46542 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8340
Vector Insertion
Chr 10: 28074586 - 28103236
Public Clones ST531 (baygenomics) IST14240A9 (tigm) IST13276H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9811
Vector Insertion
Chr 10: 28103531 - 28185563
Public Clones KST145 (baygenomics) RST098 (baygenomics) PST092 (baygenomics) KST065 (baygenomics)
Ex125 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11484
Vector Insertion
Chr 10: 28212994 - 28216714
Public Clones M110E01 (ggtc) IST12734B4 (tigm) IST12099C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35621
Vector Insertion
Chr 10: 28216752 - 28271423
Public Clones IST14393F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020042
Sequence
AGAGCAAACTAACTCTGGACTACCCTGAGCAGCCTCTGCCTAGCATGGAGAGCGGCGGCCGCGGCTGGCGGGCGACGCTGGAGACGCTTTCGCCCGCGAG

GTAGTTGGCCGACGTTGCGCAAGGACGAAAGTGCTGGCGGGTGGCCGCGGCGTCTCCGCGAGCCCCCCGACGAGGCCGGGCGGGCTGCTGGCTGGCGGAT

TTCACCGCGATTCCCCCGGAGGCTCTTTGCAAAGCTGCTTGAAACTTCTCCCAAACTCGCCATGGATGTGGCGGCCGCTGCGTTGCCTGCTTTTGTAGCT

CTCTGGCTTCTGTACCCGTGGCCTCTCCTGGGGTCGGCCCTTGGCCAGTTCTCAGCAG - UNI8149 - GTGGCTGTACTTTTGATGATGGGCCAGGG

GCTTGTGACTACCACCAGGATTTATACGATGACTTTGAGTGGGTCCATGTCAGTGCGCAGGAACCTCATTACCTGCCCCCCGAAATGCCTCAAG - UNI

10135 - GTTCCTATATGGTTGTGGACTCCTCAAATCATGATCCTGGAGAAAAAGCCAGACTTCAGCTGCCTACCATGAAGGAGAATGACACCCACTGC

ATTGATTTCAGTTACCTGTTATATAGCCAGAAGGGGTTGAACCCTGGCACTTTGAATATCCTAGTTAGGGTGAATAAAGGACCTCTTGCTAATCCAATTT

GGAATGTAACTGGATTCACTGGTCGTGATTGGCTTCGGGCTGAACTAGCTGTGAGCACCTTTTGGCCCAATGAATACCAG GTAATATTTGAAGCTGAAG

TCTCAGGAGGGAGAAGTGGTTATATTGCCATTGATGACATCCAAGTCCTGAGTTATCCTTGCG ATAAATCTCCTCATTTTCTCCGCCTTGGTGATGTGG

AGGTCAATGCTGGGCAGAATGCTACATTTCAGTGCATTGCTACAGGGAGAGATGCTGTGCATAACAAGTTATGGCTGCAG AGACGCAATGGAGAAGACA

TACCCGTAGCCCAGACTAAGAACATAAATCACAGAAGATTTGCTGCCTCTTTCAGATTGCAAGAAGTGACAAAAACTGACCAGGATTTGTACCGCTGCGT

AACTCAGTCAGAACGAGGTTCTGGGGTTTCCAATTTTGCTCAACTCATTGTGAGAG - UNI8340 - AACCACCTAGACCCATTGCTCCTCCCCAGCT

GCTTGGTGTTGGGCCTACTTACTTGCTGATCCAACTAAATGCCAACTCTATTATTGGCGATGGCCCCATCATCCTGAAAGAAGTAGAGTATCGAATGACA

TCAGGATCTTGGACAGAAACCCATGCAGTCAACGCACCAACATATAAGTTGTGGCATTTAGACCCAGATACAGAATACGAGATCCGCGTCCTGCTTACCA

GACCTGGCGAAGGGGGAACTGGGCTGCCAGGACCACCACTGATCACTAGAACGAAGTGTGCAG - UNI9811 - AACCTATGCGGACACCAAAGACTT

TAAAGATTGCTGAAATCCAGGCAAGGCGCATTGCAGTGGACTGGGAGTCCTTGGGCTACAACATCACTCGTTGCCACACTTTCAACGTCACTATCTGCTA

CCATTACTTCCGTGGCCACAATGAGAGCAGGGCAGACTGCTTGGACATGGACCCCAAAGCCCCTCAGCATGTTGTGAACCATCTGCCACCTTACACAAAT

GTCAGCCTCAAGATGATCCTAACCAACCCAGAGGGAAGGAAGGAGAGCGAAGAGACAATCATCCAAACTGATGAAGATG TGCCCGGGCCTGTGCCAGTC

AAATCCCTCCAAGGAACATCCTTTGAAAACAAGATCTTCCTGAACTGGAAAGAGCCACTGGAACCGAATGGAATTATCACTCAGTATGAG GTGAGCTAT

AGCAGCATAAGATCATTTGACCCTGCTGTTCCAGTGGCTGGGCCCCCACAGACTGTATCAAATTTATGGAATAGTACACACCATGTATTTATGCATCTTC

ACCCTGGAACCACCTACCAGTTTTTTATAAGAGCCAGCACTGTCAAAGGCTTTGGACCAGCAACAGCCATCAATGTGACCACAAATATCTCAG CTCCAA

GCTTACCTGACTATGAAGGAGTTGATGCCTCTCTGAATGAAACTGCCACCACCATCACAGTACTATTGAGGCCTGCACAAGCCAAAGGTGCTCCTATCAG

 TGCTTATCAAATTGTTGTGGAGCAGCTACACCCACATCGAACGAAGCGTGAAGCAGGGGCCATGGAATGCTACCAGGTACCGGTTACATACCAGAACGC

CCTAAGTGGGGGCGCGCCCTATTACTTTGCCGCAGAACTTCCCCCTGGGAATCTTCCCGAGCCTGCTCCCTTCACCGTGGGTGACAACCGGACCTATAAA

GGCTTTTGGAACCCTCCCCTGGCCCCCCGCAAAGGATACAACATCTATTTCCAAGCGATGAGCAGTGTGGAGAAG - UNI11484 - GAAACTAAAAC

CCAATGTGTACGAATTGCTACAAAAG CAGCAGCAACAGAAGAACCAGAAGTGATCCCAGACCCGGCAAAGCAGACAGACAGAGTGGTGAAAATCGCGGG

CATCAGTGCTGGCATCCTAGTGTTCATCCTTCTCCTGCTGGTTGTCATAGTAATTGTGAAAAAGAG CAAGCTTGCTAAGAAGCGCAAAGATGCAATGGG

GAACACACGTCAGGAGATGACCCACATGGTGAATGCTATGGACCGAAGTTATGCTGACCAGAGCACCCTGCATGCAGAAGACCCCCTTTCCCTCACCTTC

ATGGACCAACATAACTTCAGTCCAAGAT TGCCCAATGATCCACTTGTGCCGACTGCCGTGTTAG ATGAGAACCACAGTGCCACAGCAGAGTCTAGTCG

TCTCCTGGATGTTCCTCGATACCTCTGTGAAGGGACAGAGTCCCCTTATCAGACAGGACAGCTGCACCCAGCCATCAGGGTGGCCGACTTACTGCAGCAC

ATTAACCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATACGAG AGCTTCTTTGAAGGCCAGTCAGCCTCTTGGGATGTGGCTAAAAAGGAT

CAAAACAGAGCAAAGAACCGATACGGAAACATTATCGCAT ATGATCACTCCAGAGTCATCCTGCAACCTGTGGAAGATGACCCTTCTTCAGATTACATT

AATGCCAACTACATCGAC ATTTGGCTGTACAGGGAT GGCTACCAGAGACCAAGCCACTACATTGCAACTCAAG GCCCAGTTCATGAAACCGTATATG

ATTTTTGGAGGATGGTGTGGCAAGAGCAGTCTGCCTGTATTGTGATGGTCACTAATTTAGTGGAAGTTGGCCGG GTGAAATGCTATAAATATTGGCCTG

ATGATACTGAGGTTTATGGTGACTTCAAAGTCACCTGCGTAGAAATGGAGCCACTTGCTGAGTATGTCGTTAGGACATTCACCTTGGAAAGG AGGGGCT

ATAATGAAATCCGTGAAGTCAAACAGTTCCACTTCACTGGCTGGCCTGACCATGGTGTTCCATACCACGCAACAGGGCTCCTGTCATTTATCCGGAGAGT

CAAGCTATCTAACCCTCCCAGTGCTGGGCCCATTGTCGTACACTGCAG TGCTGGTGCTGGGCGCACAGGCTGTTACATTGTTATTGACATAATGCTGGA

CATGGCTGAAAGAGAGGGTGTGGTTGACATCTACAACTGTGTGAAAGCCTTACGATCTCGGCGCATTAATATGGTACAGACAGAG GAACAGTACATTTT

TATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATCCCTGTGTGTGAATTTAAAGCTGCATATTTTGATATGATTCGAATAGACTCT

CAGACTAACTCCTCTCATCTCAAAGATGAATTTCAG ACTCTGAATTCGGTCACCCCTCGACTACAAGCTGAAGACTGCAGCATAGCCTGCCTGCCAAGG

AACCATGACAAGAACCGTTTCATGGATATGCTCCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTG

CTCTTATGGAT AGCTATAGGCAGCCAGCAGCTTTCATCGTCACACAATACCCACTGCCAAACACTGTGAAAGACTTCTGGAGATTAGTATATGATTACG

GATGTACCTCCATCGTGATGCTAAATGAAGTGGACCTGTCTCAG GGCTGCCCACAGTACTGGCCAGAAGAAGGAATGCTGCGATATGGTCCTATCCAAG

TGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAATCGAATTTTTAGAATATGCAACCTAACGAGA CCACAGGAGGGCTATCTGATGGTACAAC

AGTTCCAGTACCTAGGCTGGGCTTCTCATCGAGAAGTGCCTGGCTCCAAACGCTCGTTTTTGAAATTGATACTGCAGGTGGAAAAATGGCAAGAGGAATG

TGAAGAAGGGGAAGGCCGGACAATCATCCACTGCTT GAATGGCGGTGGGCGCAGTGGCATGTTCTGTGCCATAGGCATTGTTGTGGAGATGGTGAAGCG

GCAAAATGTGGTGGATGTTTTCCATGCAGTAAAGACGCTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCG GAGCAGTATCGTTTTTGCTATGATGT

GGCGTTAGAGTACCTGGAGTCCTCATAGTTCGCTGAGACTATTTGCAGAGCATCCAAGCAGAAATCCATTCGTCTGTTGAGCCAGCAGCTGTTGTACCTG

TTACTGCACCGAGAGATTTTAATGTACGGGGTGGGAGGCTTTTACATTGGAGAGGCAAATGTATTTTTCTTATAAAGTTGTGTATCTTAATAAAAAGGAC

TTGATCAGTTTCTGTGACTGTATGAGAGCATCCACATTTCATGCCACCTAATTTTATCTTTAATCAGAGGCAGATTTGGATGAGAAGTGGTCTGTGTCTG

TCCAGTGACCACACAGCCTTTTCTCTCCTGCTTTCTGTAGAGCAGCTACCACACATTGCATGCACTTTGTAAGTGGCATTTCCCTCTCTTTTTAAAATAA

AAACTGTGGGACC
Translation
MDVAAAALPAFVALWLLYPWPLLGSALGQFSAG - UNI8149 - GGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQG - UNI10135 

- GSYMVVDSSNHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPGTLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSTFWPNEYQ VIFEAE

VSGGRSGYIAIDDIQVLSYPCD DKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQ RRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLY

RCVTQSERGSGVSNFAQLIVRE - UNI8340 - EPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLD

PDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCAE - UNI9811 - EPMRTPKTLKIAEIQARRIAVDWESLGYNITRCHTFNVTICYHYFRGHNESRA

DCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEETIIQTDEDV VPGPVPVKSLQGTSFENKIFLNWKEPLEPNGIITQYE VSYSSIRSFDPA

VPVAGPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRASTVKGFGPATAINVTTNISA APSLPDYEGVDASLNETATTITVLLRPAQAKGAPIS SAYQIV

VEQLHPHRTKREAGAMECYQVPVTYQNALSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYKGFWNPPLAPRKGYNIYFQAMSSVEK - UNI11484 - 

ETKTQCVRIATKA AAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVIVIVKKS SKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAE

DPLSLTFMDQHNFSPRL LPNDPLVPTAVLD DENHSATAESSRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYE SFFEG

QSASWDVAKKDQNRAKNRYGNIIAY YDHSRVILQPVEDDPSSDYINANYID IWLYRD GYQRPSHYIATQG GPVHETVYDFWRMVWQEQSACIVMVT

NLVEVGR VKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLER RGYNEIREVKQFHFTGWPDHGVPYHATGLLSFIRRVKLSNPPSAGPIVVHCS

 SAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSRRINMVQTE EQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQ T

LNSVTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMD SYRQPAAFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEVDL

SQ GCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTR PQEGYLMVQQFQYLGWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHC

L LNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKPNMVEAP EQYRFCYDVALEYLESS

For any suggestions or comments, please send an email to unitrap@crg.es