Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019891 (Dcbld1)
Chromosomal location
Chr 10: 51953425 - 52040081 (+)
Description
discoidin, CUB and LCCL domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:1913936]
RefSeq_dna
NM_025705 
RefSeq_peptide
NP_079981.2 
MGI
MGI:1913936 
Uniprot/SWISSPROT
Q9D4J3 
Human Ortholog
ENSG00000164465 (DCBLD1)
Omim not available
UniTrap UNI11601
Vector Insertion
Chr 10: 51953642 - 51981532
Public Clones (sanger) D121D11 (ggtc) P026C09 (ggtc) D072D07 (ggtc) IST12576A8 (tigm)
IST12085D6 (tigm) IST12303A6 (tigm) IST10810G5 (tigm) IST11075B9 (tigm)
IST14751A4 (tigm) IST12043C4 (tigm) IST11469C3 (tigm) IST14950E4 (tigm)
IST14807G5 (tigm) IST14802E6 (tigm) IST11069C11 (tigm) IST14398E7 (tigm)
IST12294H8 (tigm) IST12816F2 (tigm) IST11108B1 (tigm) IST12037B10 (tigm)
IST14518B8 (tigm)
Private Clones OST426092 (lexicon) OST351476 (lexicon) OST346998 (lexicon) OST274942 (lexicon)
OST90814 (lexicon) OST64280 (lexicon) OST59309 (lexicon) OST51168 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11147
Vector Insertion
Chr 10: 51981746 - 52003908
Public Clones (sanger) G004A07 (ggtc) G063A04 (ggtc) G073F01 (ggtc) G004C02 (ggtc)
G031G07 (ggtc) E325G07 (ggtc) M093E01 (ggtc) G054H03 (ggtc) G034C06 (ggtc)
G071G01 (ggtc) CMHD-GT_374E12-3 (cmhd) IST10403A5 (tigm) IST11549F2 (tigm)
IST10920H1 (tigm) IST11801H3 (tigm) IST15025B7 (tigm) IST10916G2 (tigm)
IST11925H4 (tigm)
Private Clones OST446174 (lexicon) OST442331 (lexicon) OST360811 (lexicon) OST300356 (lexicon)
OST33585 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10746
Vector Insertion
Chr 10: 52004044 - 52006153
Public Clones M117D06 (ggtc) G065H04 (ggtc) G034G09 (ggtc) M093E02 (ggtc) G059E12 (ggtc)
G081D07 (ggtc) G065G11 (ggtc) G042A11 (ggtc) P070B03 (ggtc) G061G04 (ggtc)
G084D08 (ggtc) P083F09 (ggtc) G059E04 (ggtc) G078B11 (ggtc) G058B11 (ggtc)
G031E11 (ggtc) G040C12 (ggtc) P073G03 (ggtc) G060H02 (ggtc) G031D04 (ggtc)
G081F04 (ggtc) G058E08 (ggtc) IST12282F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11302
Vector Insertion
Chr 10: 52006206 - 52010656
Public Clones (sanger) G067F05 (ggtc) G067G04 (ggtc) G068G09 (ggtc) IST12282F10 (tigm)
IST10578G6 (tigm) IST12681D11 (tigm) IST11475H6 (tigm)
Private Clones OST358036 (lexicon) OST245550 (lexicon) OST43807 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11077
Vector Insertion
Chr 10: 52010730 - 52024392
Public Clones (sanger) P076F06 (ggtc) G085B03 (ggtc) P077F07 (ggtc) P076F07 (ggtc)
P073E12 (ggtc) P075B07 (ggtc) G060F07 (ggtc) P077E08 (ggtc) IST10344A10 (tigm)
Private Clones OST459005 (lexicon) OST439079 (lexicon) OST389624 (lexicon) OST356022 (lexicon)
OST352350 (lexicon) OST327430 (lexicon) OST324694 (lexicon) OST314463 (lexicon)
OST205576 (lexicon) OST203879 (lexicon) OST165314 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10117
Vector Insertion
Chr 10: 52024527 - 52031205
Public Clones XST043 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27342
Vector Insertion
Chr 10: 52031247 - 52032619
Public Clones not available
Private Clones OST62568 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105476
Sequence
GCCCAGAGGGATCTGTGCCGTGTGCCCGCGCCGCGCCGGGCCGGGCCGCGAAGGAGGCTGCCCTAGGCGGGCAGCGGCAGTGTAGAGCCGGGCCGGGAGG

CCGATCCTGCGGGTCTGGAGTCCGGCGGGACCATGGGGACCGGGGCTGGTGGGCCGAGTGTCCTGGCGCTGCTGTTCGCCGTGTGTGCTCCGCTCCGGTT

GCAGGCGGAGGAGCTGG - UNI11147 - - UNI11601 - GTCCATATTGTGGGAGTTGGGCTGTTCCCAAAGAACTCCGGCTGAACTCAAACGAA

GTGACTGTCCTCTTCAAGAGTGGATCTCACATTTCTGGCCGGGGCTTTCTGCTGACCTACGCCAGCAGTGACCATCCAG - UNI10746 - ATTTAAT

AACCTGTTTGGAACGAGGCAGCCATTATTTCGAGGAAAAATACAG - UNI11302 - CAAATTCTGCCCAGCTGGCTGTAGAGACATAGCAGGAGATA

TTTCTGGGAATACAAAAGATGGTTACAGAGAT - UNI11077 - ACCTCTTTATTGTGCAAAGCTGCCATCCACGCAGGGATCATCACAGATGAACTA

GGTGGCCACATCAACTTGCTTCAGAGCAAAGGGATAAGTCACTATGAAGGACTCCTGGCCAATGGCGTGCTCTCCCGGCA - UNI10117 - TGGTTC

TTTGTCGGAAAAGCGATTTCTTTTTACAACCCCAG - UNI27342 - GAATGAATATTACAACTGTGGCGATTCCATCAGTGATCTTCATCGCCCTCC

TTCTGACTGGAATGGGGATCTTTGCAATCTGTAGAAA GAGGAAAAAGAAAGGAAATCCATATGTGTCAGCTGACGCTCAGAAAACAG GCTGTTGGAAG

CAGATTAAATATCCCTTTGCCAGGCATCAGTCGACGGAATTTACCATCAGCTATGACAATGAAAAAGAGATGACACAAAAGTTGGATCTCATCACTAGTG

ATATGGCAG ATTATCAGCAGCCTCTCATGATTGGCACAGGCACAGTCGCGAGAAAGGGCTCTACCTTCCGACCCATGGACACAGACACTGAGGAGGTCA

GAGTGAACACTGAGGCCAGCGGCCACTATGACTGTCCTCACCGCCCGGGCCGCCATGAGTACGCACTGCCTTTGACGCACTCAGAACCTGAGTATGCCAC

ACCTATCGTGGAGCGGCACCTGCTGCGAGCTCACACCTTCTCCACACAGAGCGGCTACCGAGTCCCTGGGCCCAGGCCCACTCACAAACACTCCCATTCC

TCTGGAGGCTTTCCTCCTGCTACAGGAGCCACCCAGGTTGAAAGCTATCAGAGGCCAGCAAGCCCCAAGCCTGTGGGTGGTGGCTATGACAAGCCTGCTG

CTAGCAGCTTCTTGGACAGCAGAGACCCAGCCTCTCAGTCACAGATGACTTCCGGGGGAGATGATGGTTATTCGGCACCCAGAAACGGTCTTGCGCCCCT

CAACCAGACGGCCATGACTGCTCTTTTGTGAACCCAATGTGAAAGAAACCTGCTGTGGTACTGAGCGCGCACCGCTGCGAGTCACTGGAAGAAATGTGCA

AGCGTGCATGTGTGACTCTTCAGGATCCTAGAGACGACCTCACTTACTGTTTACAGAACTGTGCAGCTGGTTTAGTTCCAACCCTTCCTGCAGAGCCAGT

TGGTTTCTGTTGTGCTAGAACAAGGGGACTTTTCTCATTTGTCTTAACTGTGATGCTGTGCTGTAAAATGTGCAATTTGTACAGTTATATTTAACACGAA

TTAACATTAC
Translation
MGTGAGGPSVLALLFAVCAPLRLQAEELG - UNI11147 - - UNI11601 - GPYCGSWAVPKELRLNSNEVTVLFKSGSHISGRGFLLTYASSDH

PD - UNI10746 - DLITCLERGSHYFEEKYS - UNI11302 - SKFCPAGCRDIAGDISGNTKDGYRD - UNI11077 - TSLLCKAAIHAGI

ITDELGGHINLLQSKGISHYEGLLANGVLSRH - UNI10117 - HGSLSEKRFLFTTPG - UNI27342 - GMNITTVAIPSVIFIALLLTGMGIF

AICRK KRKKKGNPYVSADAQKTG GCWKQIKYPFARHQSTEFTISYDNEKEMTQKLDLITSDMAD DYQQPLMIGTGTVARKGSTFRPMDTDTEEVRVN

TEASGHYDCPHRPGRHEYALPLTHSEPEYATPIVERHLLRAHTFSTQSGYRVPGPRPTHKHSHSSGGFPPATGATQVESYQRPASPKPVGGGYDKPAASS

FLDSRDPASQSQMTSGGDDGYSAPRNGLAPLNQTAMTALL
Transcript ENSMUST00000069004
Sequence
GCCCAGAGGGATCTGTGCCGTGTGCCCGCGCCGCGCCGGGCCGGGCCGCGAAGGAGGCTGCCCTAGGCGGGCAGCGGCAGTGTAGAGCCGGGCCGGGAGG

CCGATCCTGCGGGTCTGGAGTCCGGCGGGACCATGGGGACCGGGGCTGGTGGGCCGAGTGTCCTGGCGCTGCTGTTCGCCGTGTGTGCTCCGCTCCGGTT

GCAGGCGGAGGAGCTGG - UNI11601 - GTGATGGCTGTGGGCACATAGTGACCTCTCAGGACAGTGGCACAATGACATCTAAGAATTATCCAGGGA

CTTACCCCAATTACACTGTGTGTGAAAAGATCATCACAGTCCCAAAGGGGAAGAGACTTATTCTGAGGTTGGGAGATTTGAACATTGAGTCCAAGACCTG

CGCTTCTGACTATCTCCTCTTCAGCAGTGCAACAGATCAGTATG - UNI11147 - GTCCATATTGTGGGAGTTGGGCTGTTCCCAAAGAACTCCGGC

TGAACTCAAACGAAGTGACTGTCCTCTTCAAGAGTGGATCTCACATTTCTGGCCGGGGCTTTCTGCTGACCTACGCCAGCAGTGACCATCCAG - UNI1

0746 - ATTTAATAACCTGTTTGGAACGAGGCAGCCATTATTTCGAGGAAAAATACAG - UNI11302 - CAAATTCTGCCCAGCTGGCTGTAGAGA

CATAGCAGGAGATATTTCTGGGAATACAAAAGATGGTTACAGAGAT - UNI11077 - ACCTCTTTATTGTGCAAAGCTGCCATCCACGCAGGGATCA

TCACAGATGAACTAGGTGGCCACATCAACTTGCTTCAGAGCAAAGGGATAAGTCACTATGAAGGACTCCTGGCCAATGGCGTGCTCTCCCGGCA - UNI

10117 - TGGTTCTTTGTCGGAAAAGCGATTTCTTTTTACAACCCCAG - UNI27342 - GAATGAATATTACAACTGTGGCGATTCCATCAGTGAT

CTTCATCGCCCTCCTTCTGACTGGAATGGGGATCTTTGCAATCTGTAGAAA GAGGAAAAAGAAAGGAAATCCATATGTGTCAGCTGACGCTCAGAAAAC

AG GCTGTTGGAAGCAGATTAAATATCCCTTTGCCAGGCATCAGTCGACGGAATTTACCATCAGCTATGACAATGAAAAAGAGATGACACAAAAGTTGGA

TCTCATCACTAGTGATATGGCAG ATTATCAGCAGCCTCTCATGATTGGCACAGGCACAGTCGCGAGAAAGGGCTCTACCTTCCGACCCATGGACACAGA

CACTGAGGAGGTCAGAGTGAACACTGAGGCCAGCGGCCACTATGACTGTCCTCACCGCCCGGGCCGCCATGAGTACGCACTGCCTTTGACGCACTCAGAA

CCTGAGTATGCCACACCTATCGTGGAGCGGCACCTGCTGCGAGCTCACACCTTCTCCACACAGAGCGGCTACCGAGTCCCTGGGCCCAGGCCCACTCACA

AACACTCCCATTCCTCTGGAGGCTTTCCTCCTGCTACAGGAGCCACCCAGGTTGAAAGCTATCAGAGGCCAGCAAGCCCCAAGCCTGTGGGTGGTGGCTA

TGACAAGCCTGCTGCTAGCAGCTTCTTGGACAGCAGAGACCCAGCCTCTCAGTCACAGATGACTTCCGGGGGAGATGATGGTTATTCGGCACCCAGAAAC

GGTCTTGCGCCCCTCAACCAGACGGCCATGACTGCTCTTTTGTGAACCCAATGTGAAAGAAACCTGCTGTGGTACTGAGCGCGCACCGCTGCGAGTCACT

GGAAGAAATGTGCAAGCGTGCATGTGTGACTCTTCAGGATCCTAGAGACGACCTCACTTACTGTTTACAGAACTGTGCAGCTGGTTTAGTTCCAACCCTT

CCTGCAGAGCCAGTTGGTTTCTGTTGTGCTAGAACAAGGGGACTTTTCTCATTTGTCTTAACTGTGATGCTGTGCTGTAAAATGTGCAATTTGTACAGTT

ATATTTAACACGAATTAACATTAC
Translation
MGTGAGGPSVLALLFAVCAPLRLQAEELG - UNI11601 - GDGCGHIVTSQDSGTMTSKNYPGTYPNYTVCEKIITVPKGKRLILRLGDLNIESKTC

ASDYLLFSSATDQYG - UNI11147 - GPYCGSWAVPKELRLNSNEVTVLFKSGSHISGRGFLLTYASSDHPD - UNI10746 - DLITCLERGSH

YFEEKYS - UNI11302 - SKFCPAGCRDIAGDISGNTKDGYRD - UNI11077 - TSLLCKAAIHAGIITDELGGHINLLQSKGISHYEGLLANG

VLSRH - UNI10117 - HGSLSEKRFLFTTPG - UNI27342 - GMNITTVAIPSVIFIALLLTGMGIFAICRK KRKKKGNPYVSADAQKTG GC

WKQIKYPFARHQSTEFTISYDNEKEMTQKLDLITSDMAD DYQQPLMIGTGTVARKGSTFRPMDTDTEEVRVNTEASGHYDCPHRPGRHEYALPLTHSEP

EYATPIVERHLLRAHTFSTQSGYRVPGPRPTHKHSHSSGGFPPATGATQVESYQRPASPKPVGGGYDKPAASSFLDSRDPASQSQMTSGGDDGYSAPRNG

LAPLNQTAMTALL

For any suggestions or comments, please send an email to unitrap@crg.es