Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019894 (Slc6a15)
Chromosomal location
Chr 10: 102830477 - 102882011 (+)
Description
solute carrier family 6 (neurotransmitter transporter), member 15 Gene [Source:MGI Symbol;Acc:MGI:2143484]
RefSeq_dna
NM_175328 
RefSeq_peptide
NP_780537.1 
UniGene
Mm.400409 Mm.458408 
MGI
MGI:2143484 
Uniprot/SWISSPROT
Q8BG16 
Uniprot/SPTREMBL
Q333Y0 Q8BLA6 Q8R0C2 
Human Ortholog
ENSG00000072041 (SLC6A15)
Omim not available
UniTrap UNI32003
Vector Insertion
Chr 10: 102830788 - 102832005
Public Clones IST12249A5 (tigm) IST12590D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074204
Sequence
ACACACAGACATGCACATACACACATTCACATAACACGCACGCACACATACATACATACATACATTCACAGGCGCCCCAGGAACCACACGCCAGCATCCC

GTGCAATATTCCAGGCAGACACAGGCGCTCACGAGTTTCTCCGTGCCAGCTTGCAGGACAGCGACTCCCGAAACCAATCCTGCCCTTGGCAAGCTGTTTC

TGTTCTCCAGACAGCTCCTCTGCGGCCTCCCGCACCATCTGCTGGATCCGACCCTTTTTCGACCTAGGAACCTGGAAGCTGTAAGAGGTGCTAGCTCAAG

AAGCACCAGAG - UNI32003 - GTCTGAGTTCTTCCATGCAGAGCTGAGAAGAATGAGAGGAATGAAGGCTTTCCTTTGGGTACTGCATTTGGGCCC

CTTTTCGTCTTCTCTGTAAAAG GGTGTCTTTAAGAAGATTAATTTCCAATGCCTAAGAATAGCAAAGTGGTAAAGAGAGATTTGGATGATGATGTCATT

GAATCTGTCAAAGACCTCCTGTCCAACGAAGACTCAGTGGAAGAGGTTTCTAAGAAGAGTGAACTAATTGTCGATGTTCAGGAAGAGAAAGATACAGATG

CTGAAGATGGATCTGAAGCTGATGATGAAAGGCCAGCCTGGAACAGTAAGCTGCAATACATTCTGGCCCAAGTTGGATTTTCTGTAGGTCTGGGGAATGT

GTGGCGGTTCCCATACCTCTGCCAAAAGAATGGTGGTG GTGCATATCTTTTGCCGTATTTAATACTACTTCTGGTGATAGGAATTCCACTCTTTTTCCT

GGAACTTTCTGTGGGTCAAAGAATTCGAAGAGGCAGCATTGGGGTTTGGAATTACATAAGCCCTAAATTGGGTGGGATTGGCTTCGCAAGCTGTGTA GT

GTGCTATTTTGTGGCTCTCTACTACAATGTCATCATTGGCTGGACATTATTTTACTTTTCTCAGTCTTTTCAACAACCTCTTCCTTGGGATCAATGCCCC

CTGGTGAAAAACGCATCTCATACTT ATGTTGAGCCAGAATGTGAACAAAGTTCTGCCACCACCTATTACTGGTACCGGGAAGCACTGGATATCACCAGC

TCCATCTCTGACAGTGGAGGCTTAAACTGGAAGATGACGGTCTGCCTTCTGGTTGCCTGGGTCATGGTTTGTCTGGCCATGATCAAAGGCATTCAGTCCT

CTGGAAAA ATCATGTATTTCAGTTCTCTGTTCCCCTACGTGGTCCTTATATGTTTCCTAATAAGATCTCTCCTTTTAAATGGTTCAATTGATGGCATCC

GACACATGTTCACTCCTAAG CTGGAAATGATGTTGGAGCCCAAGGTTTGGAGAGAGGCAGCAACTCAGGTGTTCTTTGCATTGGGTTTGGGATTTGGTG

GAGTCATCGCGTTTTCAAGTTATAACAAGAGAGACAACAACTGCCACTTCGATGCTGTCCTAGTGTCTTTCATCAACTTTTTCACTTCAGTTCTGGCAAC

ACTGGTGGTGTTTGCAGTTCTGGGGTTCAAAGCCAATATCGTAAATGAAAAATGCATTTCACA AAACTCCGAGATGATCTTGAAACTTTTGAAAATGGG

AAACATTAGTTGGGATGTCATTCCCCATCACATCAACCTCTCAGCTGTCACTGTGGAAGATTATCGTTTAGTTTACGACATCATTCAAAAAGTGAAGGAG

GAGGAGTTTGCTGTTCTTCATCTCAACGCCTGTCAAATTGAGGATGAGCTAAATAAA GCTGTGCAGGGCACTGGCTTGGCTTTCATTGCCTTTACAGAG

GCCATGACACATTTCCCTGCATCTCCTTTCTGGTCAGTGATGTTTTTCCTCATGTTGATAAATCTCGGCCTCGGCAGCATGTTTGGAACAATTGAAGGGA

TCATCACTCCTATTGTGGATACCTTCAAAGTGAGGAAGGAAATACTCACTG TTATCTGTTGCCTCCTGGCATTTTGTATTGGCTTGATATTCGTGCAGC

GCTCTGGAAATTACTTCGTGACAATGTTTGACGATTATTCTGCTACATTGCCTCTGCTAATTGTGGTCATCTTGGAGAATATTGCCGTGAGCTTTGTTTA

TGGCATAGATAA GTTTATAGAAGACCTCACAGACATGTTAGGATTTGCTCCAAGCAAATATTACTATTATATGTGGAAATACATTTCTCCTCTAATGCT

ACTAACGTTGCTAATAGCTAGCATTGTGAATATGGGATTAAGTCCTCCCGGATATAATGCATGGATCAAGGAGAAG GCATCGGAAGAATTTCTGAGCTA

CCCGATGTGGGGGATGGTCGTCTGTTTCTCTCTGATGGTGCTGGCCATACTTCCTGTCCCAGTGGTGTTCATCATTCGTCGCTGCAACCTCATAGATGAT

AGTTCTGGTAACTTGGCCTCCGTGACCTATAAGAGAGGAAGAGTCCTGAAGGAACCTGTGAACTTGGAAGGAGATGACGCAAGCCTCATTCATGGAAAGA

TACCGAGTGAAATGTCATCTCCAAATTTTGGTAAAAATATTTATCGAAAACAAAGTGGTTCCCCAACACTGGATACTGCTCCCAATGGACGCTATGGGAT

TGGGTATTTGATGGCAGACATGCCAGATATGCCAGAGTCTGACTTGTAGCTGAACGAAAGCAGGGGTTGAGTTTGGTTAATTTTTATCAGTGAGCATCGG

TTCTCCTATGAGAAGCATTGGGCTTCACTATCACACGGTGATCTCAGGTGTCCATGGCTATGATCTTTAATCCCAACAGTTTTAGACAGTTCAAGAACAG

CAATCCTCAGTTTACATTTGCTCAGAAATGATGGCAGACAAAGCTTACATTGACTGAGGTCATATTTTGCCAGGATTTTTTAAAAAAACAAGCACTTTGG

CATATTTTCAAATATTTCTATCTCTTAAAAAAAGGTGTTACCTCAGTTTCTAATAATTTCTGGATTTAATATCATTGGCAATTTTAAAAACTCCCTGGTA

TATCTTACAATTCATAATTTTGCCTTCAGCATAAGTTCCAGTATTACCATGAACAGTTGTGTGAGCCGGTGCCTCTCAGCACATTCCCATGAGTATGTTC

TGTAGATAGTCTGTACTTAATTTTGGTAGCATTGAAACCTTCCTAGGCACTTAGTTGGAGAAAACTGCAAAGTATTTTCTTATATGATAGCCGCATAGAG

CAATAGTATCAAAGGGTAAGAAGGCACTGATACTGGGGAAAAGGTTAGGTCCAGATGTGACTTTGGGTTCCATGTGGTTGGCTGTATAATTTGTGTAAAA

TAGGTGTGTGGAAATGATTGATGGGAGTGGCTCCATACTCTCAAGAATTATGCAGACTGCATCTTTCTTATGCCGTGTGCCTAAAAGTCTACTTAATATT

TATTGTGGTTTTGAGATCACTTATAGTATATTTATATAATATACTTGCAATGCATAGAGATGCCTACCAGGACTCTTAAGTGCTGATTTGAAAACTTGAA

GCAAGATAGCATTTTGATTTCATATGTTTCTGTTTTGCTTCATTTTATGCAAATACAAATTCTTTTTTAAGTGATTGTTAAAACTGTATGGCATTACATT

TTAACCTACAAATAAACGAAGTTTAAAGAACG
Translation
 - UNI32003 -  MPKNSKVVKRDLDDDVIESVKDLLSNEDSVEEVSKKSELIVDVQEEKDTDAEDGSEADDERPAWNSKLQYILAQVGFSVGLGNVW

RFPYLCQKNGGG GAYLLPYLILLLVIGIPLFFLELSVGQRIRRGSIGVWNYISPKLGGIGFASCV VCYFVALYYNVIIGWTLFYFSQSFQQPLPWDQC

PLVKNASHTY YVEPECEQSSATTYYWYREALDITSSISDSGGLNWKMTVCLLVAWVMVCLAMIKGIQSSGK IMYFSSLFPYVVLICFLIRSLLLNGSI

DGIRHMFTPK LEMMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKANIVNEKCISQ QNSEMIL

KLLKMGNISWDVIPHHINLSAVTVEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNK AVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSM

FGTIEGIITPIVDTFKVRKEILTV VICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVSFVYGIDK KFIEDLTDMLGFAPSKYYYY

MWKYISPLMLLTLLIASIVNMGLSPPGYNAWIKEK ASEEFLSYPMWGMVVCFSLMVLAILPVPVVFIIRRCNLIDDSSGNLASVTYKRGRVLKEPVNLE

GDDASLIHGKIPSEMSSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMADMPDMPESDL

For any suggestions or comments, please send an email to unitrap@crg.es