Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019920 (Lims1)
Chromosomal location
Chr 10: 57786295 - 57887437 (+)
Description
LIM and senescent cell antigen-like domains 1 Gene [Source:MGI (curated);Acc:Lims1-001]
RefSeq_dna
NM_026148 
RefSeq_peptide
NP_080424.2 
UniGene
Mm.57734 Mm.413157 
MGI
MGI:1195263 
Uniprot/SWISSPROT
Q99JW4 
Uniprot/SPTREMBL
Q9D7B2 A8CVP4 Q4ZJB3 A8CVP1 
Human Ortholog
ENSG00000169756 (LIMS1)
Omim not available
UniTrap UNI921
Vector Insertion
Chr 10: 57786436 - 57857135
Public Clones BC0335 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29565
Vector Insertion
Chr 10: 57786436 - 57857120
Public Clones (sanger) E326C08 (ggtc) IST14843A9 (tigm) IST14165A2 (tigm) IST11570D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14446
Vector Insertion
Chr 10: 57857349 - 57861768
Public Clones FHCRC-GT-S17-11G2 (fhcrc) FHCRC-GT-S17-11G1 (fhcrc) FHCRC-GT-S12-5F1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19849
Vector Insertion
Chr 10: 57857349 - 57861768
Public Clones not available
Private Clones OST378853 (lexicon) OST367606 (lexicon) OST258395 (lexicon) OST231962 (lexicon)
OST226977 (lexicon) OST163332 (lexicon) OST157136 (lexicon) OST142214 (lexicon)
OST99813 (lexicon) OST66507 (lexicon) OST49048 (lexicon) OST35390 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26470
Vector Insertion
Chr 10: 57870885 - 57872307
Public Clones not available
Private Clones OST116058 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6228
Vector Insertion
Chr 10: 57879431 - 57881146
Public Clones CSG413 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020077
Sequence
GTATCCTGCTCGGCATCACAGGACTCTGAACTCTCAAGCTTGTACAATGGCCTTCCCAGGACGGGCACGCCCGTGCACTATCCCAGAGAATGAAGAAATC

CCCCAAACAGCCCTTAACAGCGTCCTTGAAGCTAATGGGAATGAAGACGAGAGGGCTGTGTCAAACCTGCAGCGCAGGCACAGTGACGTAAAGGTCTACA

AGGAATTCTGTGATTTTTATGCGAAATT - UNI14446 - - UNI19849 - CAACATGGCCAATGCCTTGGCCAGTGCCACGTGTGAGCGCTGCAA

GGGAGGCTTTGCGCCTGCTGAGAAGATCGTGAACAGTAATGGTGAGCTGTACCACGAACAGTGCTTCGTATGTGCTCAGTGCTTCCAGCAGTTCCCAGAA

GGACTCTTTTATGAG TTTGAAGGAAGGAAGTACTGTGAGCATGATTTCCAAATGCTCTTTGCTCCCTGCTGCCACCAATGTG - UNI26470 - GTG

AATTCATCATTGGCAGGGTTATCAAAGCCATGAACAACAGCTGGCATCCTGAGTGCTTCCGATGTGACCTCTGCCAGGAAGTGCTGGCAGACATAGGGTT

TGTCAAGAATGCTGGCAG ACACCTATGTCGCCCATGTCATAATCGTGAAAAAGCCAGAGGCCTTGGAAAATACATCTGCCAGAAATGCCATGCCATCAT

TGATGAACAGCCTCTGATCTTCAAGAACGACCCTTACCATCCAGACCACTTCAACTGTGCCAACTGCGG GAAGGAGCTAACTGCTGATGCTCGGGAGCT

GAAAGGGGAGCTATACTGTCTGCCATGCCATGATAAGATGGGGGTCCCTATCTGTGGCGCCTGCAGGAGGCCCATTGAAGGGCGAGTAGTGAATGCCATG

GGCAAGCAATGGCATGTGGAG CATTTTGTTTGTGCCAAATGTGAAAAACCATTTCTTGGGCATCGCCATTATGAGAGGAAGGGCTTGGCCTACTGTGAA

ACTCACTATAATCAG CTGTTTGGTGATGTTTGTTTCCATTGCAACCGTGTCATAGAAGGTGATG - UNI6228 - TGGTCTCTGCTCTCAACAAGGC

CTGGTGTGTGAGCTGCTTTGCCTGCTCCACCTGCAATACCAAACTCACACTCAA GGATAAGTTTGTTGAAATTGATCTAAAGCCAGTCTGCAAATACTG

TTATGAGAAAATGCCAGAAGAGTTTAAGAGGCGACTTGCCAAACGGGAGAGAGAAGCAAAGGATAAGGACAAGCAGAGAAAGAGAAAGCCAGTGT GAAT

AAATTTGTGGAATTTGACATGAAGCCAGTCTGTAAGAAGTGCTACGAGAAATTTCCTTTGGAGCTGAAGAAAAGACTTAAGAAACTATCTGAGACCTTAG

GAAGGAAATAACTTTTGGTGTCTTTTTTCTCTCTCTTCTAATCAATGTTACTTAACCTGATCTACCCTTGCTTAAAACTATGTCAGAGCATTAGAATGGT

TTTCTTCATTTCCCTTTTCTCATTTAAAAACGAAAGAAAATGTTTATTTCTATGTAAAACACAGATGAAATCAGGACTTTCATTTCTTTAGCCATATTAG

TCTGTAGGCATTAAAAGTATATAACC
Translation
MAFPGRARPCTIPENEEIPQTALNSVLEANGNEDERAVSNLQRRHSDVKVYKEFCDFYAKF - UNI14446 - - UNI19849 - FNMANALASATC

ERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYE FEGRKYCEHDFQMLFAPCCHQCG - UNI26470 - GEFIIGRVIKAMNNSWHPEC

FRCDLCQEVLADIGFVKNAGR RHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCG GKELTADARELKGELYCLPCHDKMGV

PICGACRRPIEGRVVNAMGKQWHVE HFVCAKCEKPFLGHRHYERKGLAYCETHYNQ LFGDVCFHCNRVIEGDV - UNI6228 - VVSALNKAWCVS

CFACSTCNTKLTLK KDKFVEIDLKPVCKYCYEKMPEEFKRRLAKREREAKDKDKQRKRKPV V
Transcript ENSMUST00000105468
Sequence
TCACAGGACTCTGAACTCTCAAGCTTGTACAATGGCCTTCCCAGGACGGGCACGCCCGTGCACTATCCCAGAGAATGAAGAAATCCCCCAAACAGCCCTT

AACAGCGTCCTTGAAGCTAATGGGAATGAAGACGAGAGGGCTGTGTCAAACCTGCAGCGCAGGCACAGTGACGTAAAGGTCTACAAGGAATTCTGTGATT

TTTATGCGAAATT - UNI14446 - - UNI19849 - CAACATGGCCAATGCCTTGGCCAGTGCCACGTGTGAGCGCTGCAAGGGAGGCTTTGCGCC

TGCTGAGAAGATCGTGAACAGTAATGGTGAGCTGTACCACGAACAGTGCTTCGTATGTGCTCAGTGCTTCCAGCAGTTCCCAGAAGGACTCTTTTATGAG

 TTTGAAGGAAGGAAGTACTGTGAGCATGATTTCCAAATGCTCTTTGCTCCCTGCTGCCACCAATGTG - UNI26470 - GTGAATTCATCATTGGCA

GGGTTATCAAAGCCATGAACAACAGCTGGCATCCTGAGTGCTTCCGATGTGACCTCTGCCAGGAAGTGCTGGCAGACATAGGGTTTGTCAAGAATGCTGG

CAG ACACCTATGTCGCCCATGTCATAATCGTGAAAAAGCCAGAGGCCTTGGAAAATACATCTGCCAGAAATGCCATGCCATCATTGATGAACAGCCTCT

GATCTTCAAGAACGACCCTTACCATCCAGACCACTTCAACTGTGCCAACTGCGG GAAGGAGCTAACTGCTGATGCTCGGGAGCTGAAAGGGGAGCTATA

CTGTCTGCCATGCCATGATAAGATGGGGGTCCCTATCTGTGGCGCCTGCAGGAGGCCCATTGAAGGGCGAGTAGTGAATGCCATGGGCAAGCAATGGCAT

GTGGAG CATTTTGTTTGTGCCAAATGTGAAAAACCATTTCTTGGGCATCGCCATTATGAGAGGAAGGGCTTGGCCTACTGTGAAACTCACTATAATCAG

 CTGTTTGGTGATGTTTGTTTCCATTGCAACCGTGTCATAGAAGGTGATG - UNI6228 - TGGTCTCTGCTCTCAACAAGGCCTGGTGTGTGAGCTG

CTTTGCCTGCTCCACCTGCAATACCAAACTCACACTCAA GAATAAATTTGTGGAATTTGACATGAAGCCAGTCTGTAAGAAGTGCTACGAGAAATTTCC

TTTGGAGCTGAAGAAAAGACTTAAGAAACTATCTGAGACCTTAGGAAGGAAATAACTTTTGGTGT
Translation
MAFPGRARPCTIPENEEIPQTALNSVLEANGNEDERAVSNLQRRHSDVKVYKEFCDFYAKF - UNI14446 - - UNI19849 - FNMANALASATC

ERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYE FEGRKYCEHDFQMLFAPCCHQCG - UNI26470 - GEFIIGRVIKAMNNSWHPEC

FRCDLCQEVLADIGFVKNAGR RHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCG GKELTADARELKGELYCLPCHDKMGV

PICGACRRPIEGRVVNAMGKQWHVE HFVCAKCEKPFLGHRHYERKGLAYCETHYNQ LFGDVCFHCNRVIEGDV - UNI6228 - VVSALNKAWCVS

CFACSTCNTKLTLK KNKFVEFDMKPVCKKCYEKFPLELKKRLKKLSETLGRK
Transcript ENSMUST00000020078
Sequence
TGCCTGGGACCGGCCCTCAAATCGACTGCTCGCCGCCGCAGCGAGGGAAGAGGGTGCGGCCGCCGCGGCGGGGACTGAGGCACAGACTGACCCGGCGTGG

ACCGCGGAGATGCTGGGCGTGGCGGCCGGAATGACCAACAG - UNI921 - - UNI14446 - - UNI19849 - - UNI29565 - CAACATGG

CCAATGCCTTGGCCAGTGCCACGTGTGAGCGCTGCAAGGGAGGCTTTGCGCCTGCTGAGAAGATCGTGAACAGTAATGGTGAGCTGTACCACGAACAGTG

CTTCGTATGTGCTCAGTGCTTCCAGCAGTTCCCAGAAGGACTCTTTTATGAG TTTGAAGGAAGGAAGTACTGTGAGCATGATTTCCAAATGCTCTTTGC

TCCCTGCTGCCACCAATGTG - UNI26470 - GTGAATTCATCATTGGCAGGGTTATCAAAGCCATGAACAACAGCTGGCATCCTGAGTGCTTCCGAT

GTGACCTCTGCCAGGAAGTGCTGGCAGACATAGGGTTTGTCAAGAATGCTGGCAG ACACCTATGTCGCCCATGTCATAATCGTGAAAAAGCCAGAGGCC

TTGGAAAATACATCTGCCAGAAATGCCATGCCATCATTGATGAACAGCCTCTGATCTTCAAGAACGACCCTTACCATCCAGACCACTTCAACTGTGCCAA

CTGCGG GAAGGAGCTAACTGCTGATGCTCGGGAGCTGAAAGGGGAGCTATACTGTCTGCCATGCCATGATAAGATGGGGGTCCCTATCTGTGGCGCCTG

CAGGAGGCCCATTGAAGGGCGAGTAGTGAATGCCATGGGCAAGCAATGGCATGTGGAG CATTTTGTTTGTGCCAAATGTGAAAAACCATTTCTTGGGCA

TCGCCATTATGAGAGGAAGGGCTTGGCCTACTGTGAAACTCACTATAATCAG CTGTTTGGTGATGTTTGTTTCCATTGCAACCGTGTCATAGAAGGTGA

TG - UNI6228 - TGGTCTCTGCTCTCAACAAGGCCTGGTGTGTGAGCTGCTTTGCCTGCTCCACCTGCAATACCAAACTCACACTCAA GAATAAAT

TTGTGGAATTTGACATGAAGCCAGTCTGTAAGAAGTGCTACGAGAAATTTCCTTTGGAGCTGAAGAAAAGACTTAAGAAACTATCTGAGACCTTAGGAAG

GAAATAACTTTTGGTGTCTTTTTTCTCTCTCTTCTAATCAATGTTACTTAACCTGATCTACCCTTGCTTAAAACTATGTCAGAGCATTAGAATGGTTTTC

TTCATTTCCCTTTTCTCATTTAAAAACGAAAGAAAATGTTTATTTCTATGTAAAACACAGATGAAATCAGGACTTTCATTTCTTTAGCCATATTAGTCTG

TAGGCATTAAAAGTATATAACCAAAAACAAAAACAAACAAAAAAAAAAGGTTAAAGGGTAGTTTTAATTAAGCCATCCAAAATATAAATTTAACTTCAGA

GTTAAACACCCTGCTCTATGGACCAACCAAAGCACTTGCTGCCAGCCTAGTACTAAGTTGAATCCTTAAGAGAGTATCTGAGACAGTGTCCACATGGGTC

ATGTGGAGCAAGAACTTACTCCCACAAGTTGTTCTCTAACCTCCACAGATGGCCATGGTGCATATGCGCCAACACACAGTTAATAAACATAATAGACAAC

CACTGTTATAAAGAGTCAGCTTTCACGGGACTCACATAAGCTTTGCTTCCCTGATCGCATAAGAAAATCATTTCCCATTCATATACTGGGAACTGTATGG

GAAGATAAGTGCCCAAACAGTTCCTATGTTGTCATGTGCTTATCCAGTTAGCATTGTAAAAGGAACATGCATATTACTAAGAAGCAAAAACATTTCAGGA

TGACTGATTTCTTTTTTTATTAAATCACTAAGCTTAGTTTTCTATTTTGTTCTCCTTATAAATTTTTCCTTCATAAAATTACTTAACATACTTGTAACTA

CTAATGCATCTTTTACATTTTTAAGCAAAACAAAACAAAAATTTGCCAGTTATCTGGAAAATATTGCATACATTGTGATGTTGGGGAAATGAAGCATTTT

AAAACTATATTACACATAAAATGCATAGTATTCAAATGGGACATGAAATGCACTATAATGCAGCTTCGAATGTATGGCTTTCAAAAGTGAGCGTGAGCCA

GGTGTGGTGGCACTAGGCTTCAATCCCAGCTCTCTGCAGGCAGATCTCTGTGAGTCCTAGGCCACCCAGGGCTGCATATTAAAACCTTGTTTCAGAAAGA

ATGACTGTATCTCGTATTATCTTTGTGCTAATATCTATACTTCATACATAATCTAACTTGCCTTGCCTTAGAAAACTGCATCCTATATCAGGAATTCTAG

ATATTTCTTATAATATCAAAATGAGTATTTTGATTGAGATTCATAAATTTAGAATCATTCACCACTGATACATACTTTAAAAATTCTTTTCTCAGGAAGC

CAGTGAAAGTTAATTCCTGTCCTCTTATTAGAACTATGCTGATATACTAAAACATTTTAATGAAGGCTTTTTTATTTCAAATGTCATAACTGGGTTTTGT

TTACTATAAAGCAGTAAAGCAGTATAAATGATACCTTTAGACTGAAAGAGGGTGGTAAGAGTATCAACTCTAAGGAAAAATTGGGGAGTTCTACTTTATA

AAACTGTTTATCCTGAAATGTCTGGGCCATTCTGTTTGTATGAACTCAATATGCAAGAGTATGAACATTTTTTAAATTTTTCTGCTGCTAACATGTTACC

TTCTTTTTCAGTTGCCAAGATATATTTTGCAAATACTGCTGAATATAATGACTCACATTGTAGTCTCAGCATTTGGGAGGCTGAGGCAGAAAGATTACCA

GGAGTTGGAGACAAATCCTAGGTTACAGTGTGAGATACTATCCCCCAAAACATCCCCACAAACAAAAACACTAGTGTATTGTTTTGCCGTAAAGAATATC

TCTGGGGCCTAGGAAAACGTTCAGTCAGTAATGGACTCACACCAGCCTTAGGACCTGAGTTTAAACTTGGAGGGAGCAGATCCCTGGATTTTACGAGGTA

GCCAAACTCAGCCTAACTAGTGAGCCCCAGATCCAAGGGGGAAATCCTGTATTCCAAAAAGCAAGGTGGATGCCTCCTGAGGAAGGGCCGCCTAGACTGA

TCCCTAGCCTCCACATCCACACACACACATGCACACATTCAGAAATATGGATGTGTACACACAAAAAGGATATCTCAGGATGCTGTTACTCTGCCATTAA

AAGTTTATAATCATGAATTTTTAAAATACTTGATTATGCACATTATGGAATACATTTCTGTTTCCAGATAACTAACTTGTAACCAATCATTTTATTTCCT

AATATCCTTTTCATATTAAGAGAATTATATGTGACTAAAAATATACATGATTTGTGTTTGTTAAGCATTTTAAATTTGTCTTTGCTTTTGACAATAAGAA

CCAAAATTTCTTCCGTGTGCCTTTGTCAGCTAAGAATGACTAGCAGTGGCTACCTTAGAAGTATTTATGAACTATTGTACATGCGTTTAGGCAGATAGAA

CTTGTAGTCTAGCGTCTTGATGTAACTTACATACCTCACTGGAAGTATGGAGCAGAAAAGCACTCATTCCCGTGCTTTCCCCATCCCTTTCGAGGTGTGT

GGCCTTGCCTGACTGCCTTTGCTTACGTGACATCGCTTAAGCCAGAGTCCCCACTGCTGTCTTTGCTCACTTCTCTTCAGACAGGAATATTCCAGTAAGT

TTGATCTCATAATTATGTGGTAATTCATCTAGAGATGGTGCTTTTCACTGTGGGGTAAATCATTAGAGCCCTTAGTGTGGAAGATGGAGGTCTAAATGGG

GCCAAGACAGAGACTTCATCTACTTCCTATTAGTTGTGGGGTTTCACTGGCTGCTGGCATTTGTCAGTGAACATCTGTTTGAATTTCTGAGAACAATCTG

AAATAATTCATTGTGCTTATGAAATTTCTAAGTGCCCTTTTTGTCCTTATCCTAATATAACATGGAAAATGGATACACAAAAAAGATTTTTTGTGTCATG

TTCAAAGCCTTATTATAACACTTTGCCTGAAATAGGTCATTTTGCCTCATCCATTTGCCAAATTAGCCAATTTCAAGTTAGGGAAACTTTGATGTAGGCT

GACAATATCCTTGTATTTTATTTTAGATTGTAAGCTTAATGGCAAGAAATTATATCAATAATTGTGCTTTTTATGTAGCAACCATTGCTGTGTACTTTTG

GTGCTTAATAAATATTCATAATTATTCA
Translation
MLGVAAGMTNS - UNI921 - - UNI14446 - - UNI19849 - - UNI29565 - SNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCF

VCAQCFQQFPEGLFYE FEGRKYCEHDFQMLFAPCCHQCG - UNI26470 - GEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGR RHLC

RPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCG GKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVE 

HFVCAKCEKPFLGHRHYERKGLAYCETHYNQ LFGDVCFHCNRVIEGDV - UNI6228 - VVSALNKAWCVSCFACSTCNTKLTLK KNKFVEFDMKP

VCKKCYEKFPLELKKRLKKLSETLGRK

For any suggestions or comments, please send an email to unitrap@crg.es