Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019986 (Ahi1)
Chromosomal location
Chr 10: 20672465 - 20800234 (+)
Description
Abelson helper integration site 1 Gene [Source:MGI Symbol;Acc:MGI:87971]
RefSeq_dna
NM_026203 
RefSeq_peptide
NP_080479.2 
UniGene
Mm.253280 
MGI
MGI:87971 
Uniprot/SWISSPROT
Q8K3E5 
Uniprot/SPTREMBL
Q3KQM7 Q3TM46 
Human Ortholog
ENSG00000135541 (AHI1)
Omim 608629 - JOUBERT SYNDROME 3  
UniTrap UNI17680
Vector Insertion
Chr 10: 20672559 - 20679417
Public Clones not available
Private Clones OST438254 (lexicon) OST338033 (lexicon) OST32482 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11032
Vector Insertion
Chr 10: 20691963 - 20696802
Public Clones A057E08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11021
Vector Insertion
Chr 10: 20708491 - 20720311
Public Clones A048D03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33282
Vector Insertion
Chr 10: 20737840 - 20760991
Public Clones IST12460H3 (tigm) IST12026F4 (tigm) IST13124B3 (tigm) IST13095A4 (tigm)
IST13285H6 (tigm) IST13126H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32464
Vector Insertion
Chr 10: 20761048 - 20774786
Public Clones IST10275D6 (tigm) IST14868H7 (tigm) IST11074G8 (tigm) IST10659F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34221
Vector Insertion
Chr 10: 20774950 - 20777958
Public Clones IST10725E5 (tigm) IST10189G11 (tigm) IST14727B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25322
Vector Insertion
Chr 10: 20792348 - 20792408
Public Clones not available
Private Clones OST187843 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24209
Vector Insertion
Chr 10: 20792408 - 20794180
Public Clones not available
Private Clones OST230918 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16148
Vector Insertion
Chr 10: 20794284 - 20798889
Public Clones CMHD-GT_424C4-3 (cmhd)
Private Clones OST466039 (lexicon) OST5387 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105525
Sequence
AGCACGTGAAGATTCAGAGGACAATGTTAGTGTAGAGCCATACAAACAAGAAAAGACAAGTAAACACTACCCAGATCGCACAGGAAATGGAGCCAGAAAC

TCCAGAGAAGGTGGATTCTGCACAAGAGAAAGTCAGAGGCAAGACCCCGACAGCAGATGATTCAGATGACAGCCGAGAAAAGACTGGCATAGAAGAGAAA

GGAGAACTGACCGACGCCTATCAGCTGCAGGTAGCTGAAGAAATGGCAAAGGAGATCAAGAAGAAAATAAGAAAGAAGCTAAAGGAACAGCTGACCTACT

TTCCTCCAGACACTCTATTGCATGACGACAAGCTGGCCAGTGAAAAAAGAAAGAAGAAGAAGAAGAAAGTGCCAGTGCCCACTAAGCCTGAGTCAAG TC

CCTCAGATGTCTGTGACAGTGCAGTTGAAGGGGAACAAAAGAAAGAAGGTACCCCTGAGGACTCTCAGCACATGGAGGGAATCTGCTCGAGAGAGCAGGA

TGTGGATGCCACTGTGCCAGAGAACGCAAAGCCCAAACCCAAGAAGACAAAGAAGAAGACTAAAGCAG TTTCAAATGATAATGAAGACACTAATGGAGA

TGGTGTTCATGAGATAACAAGCCGAGACAGCCCAGTTCATCCCAAGTGCTTGCTGGATGATGACCTCGTCATGGGAGTCTACATTCACCGAACCGATAGA

CTTAAATCTGACTTTATGATTTCTCACCCAATGGTAAAGATCCATGTGGTTGATGAGCACACTGGCCAGTACGTCAAGAAAGATGACAG TGAACGTCCT

GTTTCATCTTATTATGAGAAAGACAACGTGGACTATATTCTCCCTATTATGACACAGCCATATGACTTTAAAAAGCTAAAGTCAAGGCTTCCGGAGTGGG

AGGAGCAAGTTATTTTTAATGAAAATTTTCCCTATTTGCTTCGAGAGTTTGAAGAATGTCCAAAAGTCATCCTGTTCTTTGAG ATTCTTGACTTTTTAA

GCATGGATGAAATCAAGAATAACTCTGAGGTTCAAAACCAAGAGTGTGGCTTTCGGAAAATTGCCTGGGCGTTTCTTAAG CTTCTGGGAGCCAATGGGA

ATGCAAACATCAACTCAAAACTTCGCCTGCAGCTCTACTACCCACCGACTAAGCCTCGATCCCAGCTAAATGTCGTCGAGGTTTTTGAATGGTGGTCCAA

GTGTCCAAGAAATCGTTATCCATCAACATTGTATGTAACCGTACGAGGATTGAAAGTCCCGGACTGT ATAAAGCCATCTTACCGCTCTATGATGGCTCT

CCAGGAGGAAAGGGGTACACCAGTGTACTGTGAACGTCACCGTGAAACAAGTTCCGTGGACACAGAACCTGGACTAGAAGATTCAAAGGAGGAAGTGAAG

TGGAAACGTCTGCCTGGCCAG GCCTGTCGTATCCCAAACAAGCATCTCTTCTCACTGAATGCTGGAGAACGCGGCTGTTTCTGTCTTGATTTCTCTCAC

AATGGAAGGATATTAGCAGCAGCCTGTGCCAGCCGAGACGGATATCCGATTATAT - UNI11032 - TATATGAAATTCCTTCTGGACGTTTTATGAG

AGAATTGTGTGGCCACCTCAATATCATTTATGATCTCGACTGGTCAAAAGACGATCGCTATCTCGTTACTTCATCCTCTGACGGCACTGCCAG AGTTTG

GAAGAATGAAATCAATAGCACGAGCACGTTCAGAGTCTTACCTCACCCCTCCTTCGTCTACACGGCTAAATTCCACCCAGCCACACGGGAGCTGGTGGTT

ACAGGATGCTACGACTCTATGATAAGGATTTGGAAAATTGATGCAAGGGAGGATGCTGCCATATTAGTGCGCCAGTTGGATGTGCACAAGAGCTTTGTCA

ACTCCATCTGTTTTGACGATGAAG GTCACCACATGTACTCAGGAGACTGCATCGGGGTCATCGTTGTCTGGGACACGTACGTCAAAGTGAATGATGTGC

AACACTCCGTGCGCCACTGGACGATAAATAAG GAAATTAAGGAAACTGAATTCAGGGGAGTTCCAATAAGTTACCTGGAGGTTCATCCCAATGGAAAGC

GTTTGCTAATCCACACCAAAGACAGTACTCTGAGGATTATGGACCTGCGGAT ATTGGCAGCCAGGAAATTTGTGGGTGCAGCAAATTACCGTGAGAAGA

TCCATAGCACCTTGACGCCGTGCGGGACTCTGCTCTTTTCTGGGAGTGAGGATGGGATAGTATACGTTTGGAACCCAGAGACAG GAGAACAAGTGGCAA

TGTACTCTGACCTGCCATTCAAGTCCACAATCCGAGACATCTCTTACCACCCCCTGGAGAATATGGTTGCCTTCTGTGCCTTTGGACAGAGCGAGCCGAT

TCTTCTTTATATTTATGATTTCCAGG - UNI11021 - TAGCCCAGCAGGAGGCTGAAATGTTGAAACGCTATAGTGGGACACTCCCGTTGCCTGGGA

TACATCAGAGTGAGGATGCTTTATGCACCTGCCCTAAGCTGCCCCAGCAGGGCTCTTTTCAGATTGATGAATTTGTCAACACTGAAAATAGTTCATCAAG

AAAGATTCAACTTGTGAAACAGAGACTCGAAACTGTCACA GAGGTGATACGATCCTGTGCTGCAAAA GTCAACAAAAATCTCTCAATGACTTCGCCAC

CACCAGGCCCTGCAAAGAAGCCCAGGGTAAAGCAGTCGTTCGTGCTGACCACTGATGAGATCATACATCAGTTTGGACTCCCCCAGACTG - UNI3328

2 - CATTTATCAGCATAGAGAGAGGGCCTTTTGTGCGCCATGTTGATCCACCACCAATG - UNI32464 - GTAGTGGCTCTTTATGACTACACAGC

CAGCCGATCAGATGAACTAACCATCCATCGTGGAGACATTATCCGAGTGTATTTCAAAGATAATGAAGACTGGTGGTACGGCAGCGTAAGAAAGGGGCAG

GAAGGGTTCTTTCCAGCTAATCATGTGGCCAGTGAAA - UNI34221 - CACTGTATCGAGACTCCCCTCCGAAGGTAAAGGAGCGCTCCCCTCCTTT

AACTCCCAAGGAGAAAACTAAACCAGAAAAGCCTCTGGCTTCTCAAAAG GGTGGCCATGAAGAGGAGACGAAGTCACAAACCAACTGAGAGGTGTGTGT

GGAAAGGAGGGAAGGAAGGGCCGGCTGCCATGCTCCTTGGCCTCGCTGATGGTGGGGGGGGCACTTGTGGGCTGATTGCGGTCCAGCCGTGGGGGCTTTT

GTTTAAGATAAAATAAAACAGCTGACAGAGACAACTCCTTCTTCCCCCTCCTACTGCCTCCATGAGCACTTCCCATATGGCTGCTGCTGCTGAGACCAAG

GAATGA - UNI25322 - CAGTCGCTCAGTAAGGGCAGACCCCTGGATCCCAGACTGGGCCCGCAGCCTGTGGGGCA - UNI24209 - - UNI25

322 - TTCTGAGAAGGGCAAAGATCAAAACGTGGAGGACCGAGGACACAAAGTAGATATGGAGACAAAGAAAAGCGAGCCGGTGGTCCGCAAAGTCACC

CTGATAGAG - UNI16148 - TAAAAAGCTGGAGACGAAGCAGAAGCCGCCTGATGAGTGCACATGATGTGACGTCCACGCCAGACGGAGTTCTCGTT

AGATTTTGGGTGAAAAGAAGCAGTATTTATTGACCTTAAAAATCTGAAGCAAACTTAGCTCTAAAAAGAAAAAAATCACTGTGGCCTTTGGGCTTAATTG

TTATGAACCATTGTGAGTGTTACTGGTCAAAGTATTGTGCTTGTGCTATTAGTAACTACATCAGAATTATATTGCTGCTGCTGGAAAAGCCAATAGAGAA

AACCCCAGAACTGCTACTCAGTAAATGTGAATAACAGTGTGCGCAGTGTTAGTCATTCACTAAGCCATCATCCCGTGTACTTGTGGCCATGATGTGGCTG

TGCCGTAGGCCGTCATCCCGTGTACTTGTGGCCATGATGCAGATGCTCTGCTTTTGAAGTTAGCCGCGTGTAAAACCTAAGTAGCTGCTGGATATTGTGT

CTTCAAACAGCCCCAGTAACAAACGCGGTAGAAACGACAGTTTGCTTTTGAGAACTAAATGTTTGTGTTTCCCTTGAGTGAATGTATGTCACTCAACACT

CCTAGACTAAGAATGATTTTGGCTGGACTGACAACAGTACACCAAATTTATTTTTATTTTTTAGACAGAGTTTATATTTAACAGCATAAGTAATTTATGG

ATGTAAACTCTGTAGTGGTTATAGTTTAGTCTGAATATTTGTTTTTAAATTATTACACAGCATTATTTATGTCTTTAGTTTCAGAATAACAGTGCCATTA

CCATATGTTTGTATGTTGCAGTTGGATATAGCTGAGACTCCTCCATCTTGGTTTTCTCTTCACTCATCCATTTCTTCAGCTGCATGATAAGTCTGTCAGT

AAAGCATTTAACCCCAACAAGGTCAGACTATGGTAAAGTTAGAAAAACATATTTACCGAAGTACACAATTGATCTCATTGAAATAAGAAGTGAGAACCGC

TCTGTTGAGCACTGAGGTGTAAACGTGCCCAGATGCACAGCGTGAGTAGCTTCGAGTACGCATCTGTTTGCACATGTTGTAGAAGCTTAAAATGGGAACA

TGACCCTGCTGTGGAGAACCTTGGTAGAATTGTTGTTAGTACTAAAGGAGATTTCCAGCGCATACAGGGTGGCACTGAAAACTGCTGAAGCCCACAGCCC

TCAGCCCCGAAGGCTCAGCGGCCAGTACCAGCGGCCTTGCTGTGGTTGTGTGTCTGCGTCCCTGGCACACTTGGGCAGGCAGCTCAGTCACTCTGAACTT

GCTTCTCTTCTGTCTTGTGAGTGTGCTGCTTGAGACAATGAAAAATAAAGCTGTGTTCCTACCCCTTC
Translation
MEPETPEKVDSAQEKVRGKTPTADDSDDSREKTGIEEKGELTDAYQLQVAEEMAKEIKKKIRKKLKEQLTYFPPDTLLHDDKLASEKRKKKKKKVPVPTK

PESS SPSDVCDSAVEGEQKKEGTPEDSQHMEGICSREQDVDATVPENAKPKPKKTKKKTKAV VSNDNEDTNGDGVHEITSRDSPVHPKCLLDDDLVMG

VYIHRTDRLKSDFMISHPMVKIHVVDEHTGQYVKKDDS SERPVSSYYEKDNVDYILPIMTQPYDFKKLKSRLPEWEEQVIFNENFPYLLREFEECPKVI

LFFE ILDFLSMDEIKNNSEVQNQECGFRKIAWAFLK LLGANGNANINSKLRLQLYYPPTKPRSQLNVVEVFEWWSKCPRNRYPSTLYVTVRGLKVPDC

 IKPSYRSMMALQEERGTPVYCERHRETSSVDTEPGLEDSKEEVKWKRLPGQ ACRIPNKHLFSLNAGERGCFCLDFSHNGRILAAACASRDGYPIIL -

 UNI11032 - LYEIPSGRFMRELCGHLNIIYDLDWSKDDRYLVTSSSDGTAR RVWKNEINSTSTFRVLPHPSFVYTAKFHPATRELVVTGCYDSMIR

IWKIDAREDAAILVRQLDVHKSFVNSICFDDEG GHHMYSGDCIGVIVVWDTYVKVNDVQHSVRHWTINK EIKETEFRGVPISYLEVHPNGKRLLIHTK

DSTLRIMDLRI ILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYVWNPETG GEQVAMYSDLPFKSTIRDISYHPLENMVAFCAFGQSEPILLY

IYDFQV - UNI11021 - VAQQEAEMLKRYSGTLPLPGIHQSEDALCTCPKLPQQGSFQIDEFVNTENSSSRKIQLVKQRLETVT EVIRSCAAK VN

KNLSMTSPPPGPAKKPRVKQSFVLTTDEIIHQFGLPQTA - UNI33282 - AFISIERGPFVRHVDPPPM - UNI32464 - VVALYDYTASRSDE

LTIHRGDIIRVYFKDNEDWWYGSVRKGQEGFFPANHVASET - UNI34221 - TLYRDSPPKVKERSPPLTPKEKTKPEKPLASQK GGHEEETKSQT

N - UNI25322 -  - UNI24209 - - UNI25322 -  - UNI16148 - 
Transcript ENSMUST00000095801
Sequence
GCCAGCGGTCCTGCCGGCCAAGCTGCCGCCTCCCTCGTCCTCGCCTAGGCGCAGGGAACCGCTTCGCGCCGCCGCCGGGCTGTCCCTCCTCTCT - UNI

17680 - CCTGTTACCCTCAAAGTAACCTTCTGGCTACCTTAGAACTAAAATTGGCACTAAAAGCCTAGAGAAGTGAGCAGCACGTGAAGATTCAGAGG

ACAATGTTAGTGTAGAGCCATACAAACAAGAAAAGACAAGTAAACACTACCCAGATCGCACAGGAAATGGAGCCAGAAACTCCAGAGAAGGTGGATTCTG

CACAAGAGAAAGTCAGAGGCAAGACCCCGACAGCAGATGATTCAGATGACAGCCGAGAAAAGACTGGCATAGAAGAGAAAGGAGAACTGACCGACGCCTA

TCAGCTGCAGGTAGCTGAAGAAATGGCAAAGGAGATCAAGAAGAAAATAAGAAAGAAGCTAAAGGAACAGCTGACCTACTTTCCTCCAGACACTCTATTG

CATGACGACAAGCTGGCCAGTGAAAAAAGAAAGAAGAAGAAGAAGAAAGTGCCAGTGCCCACTAAGCCTGAGTCAAG TCCCTCAGATGTCTGTGACAGT

GCAGTTGAAGGGGAACAAAAGAAAGAAGGTACCCCTGAGGACTCTCAGCACATGGAGGGAATCTGCTCGAGAGAGCAGGATGTGGATGCCACTGTGCCAG

AGAACGCAAAGCCCAAACCCAAGAAGACAAAGAAGAAGACTAAAGCAG TTTCAAATGATAATGAAGACACTAATGGAGATGGTGTTCATGAGATAACAA

GCCGAGACAGCCCAGTTCATCCCAAGTGCTTGCTGGATGATGACCTCGTCATGGGAGTCTACATTCACCGAACCGATAGACTTAAATCTGACTTTATGAT

TTCTCACCCAATGGTAAAGATCCATGTGGTTGATGAGCACACTGGCCAGTACGTCAAGAAAGATGACAG TGAACGTCCTGTTTCATCTTATTATGAGAA

AGACAACGTGGACTATATTCTCCCTATTATGACACAGCCATATGACTTTAAAAAGCTAAAGTCAAGGCTTCCGGAGTGGGAGGAGCAAGTTATTTTTAAT

GAAAATTTTCCCTATTTGCTTCGAGAGTTTGAAGAATGTCCAAAAGTCATCCTGTTCTTTGAG ATTCTTGACTTTTTAAGCATGGATGAAATCAAGAAT

AACTCTGAGGTTCAAAACCAAGAGTGTGGCTTTCGGAAAATTGCCTGGGCGTTTCTTAAG CTTCTGGGAGCCAATGGGAATGCAAACATCAACTCAAAA

CTTCGCCTGCAGCTCTACTACCCACCGACTAAGCCTCGATCCCAGCTAAATGTCGTCGAGGTTTTTGAATGGTGGTCCAAGTGTCCAAGAAATCGTTATC

CATCAACATTGTATGTAACCGTACGAGGATTGAAAGTCCCGGACTGT ATAAAGCCATCTTACCGCTCTATGATGGCTCTCCAGGAGGAAAGGGGTACAC

CAGTGTACTGTGAACGTCACCGTGAAACAAGTTCCGTGGACACAGAACCTGGACTAGAAGATTCAAAGGAGGAAGTGAAGTGGAAACGTCTGCCTGGCCA

G GCCTGTCGTATCCCAAACAAGCATCTCTTCTCACTGAATGCTGGAGAACGCGGCTGTTTCTGTCTTGATTTCTCTCACAATGGAAGGATATTAGCAGC

AGCCTGTGCCAGCCGAGACGGATATCCGATTATAT - UNI11032 - TATATGAAATTCCTTCTGGACGTTTTATGAGAGAATTGTGTGGCCACCTCA

ATATCATTTATGATCTCGACTGGTCAAAAGACGATCGCTATCTCGTTACTTCATCCTCTGACGGCACTGCCAG AGTTTGGAAGAATGAAATCAATAGCA

CGAGCACGTTCAGAGTCTTACCTCACCCCTCCTTCGTCTACACGGCTAAATTCCACCCAGCCACACGGGAGCTGGTGGTTACAGGATGCTACGACTCTAT

GATAAGGATTTGGAAAATTGATGCAAGGGAGGATGCTGCCATATTAGTGCGCCAGTTGGATGTGCACAAGAGCTTTGTCAACTCCATCTGTTTTGACGAT

GAAG GTCACCACATGTACTCAGGAGACTGCATCGGGGTCATCGTTGTCTGGGACACGTACGTCAAAGTGAATGATGTGCAACACTCCGTGCGCCACTGG

ACGATAAATAAG GAAATTAAGGAAACTGAATTCAGGGGAGTTCCAATAAGTTACCTGGAGGTTCATCCCAATGGAAAGCGTTTGCTAATCCACACCAAA

GACAGTACTCTGAGGATTATGGACCTGCGGAT ATTGGCAGCCAGGAAATTTGTGGGTGCAGCAAATTACCGTGAGAAGATCCATAGCACCTTGACGCCG

TGCGGGACTCTGCTCTTTTCTGGGAGTGAGGATGGGATAGTATACGTTTGGAACCCAGAGACAG GAGAACAAGTGGCAATGTACTCTGACCTGCCATTC

AAGTCCACAATCCGAGACATCTCTTACCACCCCCTGGAGAATATGGTTGCCTTCTGTGCCTTTGGACAGAGCGAGCCGATTCTTCTTTATATTTATGATT

TCCAGG - UNI11021 - TAGCCCAGCAGGAGGCTGAAATGTTGAAACGCTATAGTGGGACACTCCCGTTGCCTGGGATACATCAGAGTGAGGATGCT

TTATGCACCTGCCCTAAGCTGCCCCAGCAGGGCTCTTTTCAGATTGATGAATTTGTCAACACTGAAAATAGTTCATCAAGAAAGATTCAACTTGTGAAAC

AGAGACTCGAAACTGTCACA GAGGTGATACGATCCTGTGCTGCAAAA GTCAACAAAAATCTCTCAATGACTTCGCCACCACCAGGCCCTGCAAAGAAG

CCCAGGGTAAAGCAGTCGTTCGTGCTGACCACTGATGAGATCATACATCAGTTTGGACTCCCCCAGACTG - UNI33282 - CATTTATCAGCATAGA

GAGAGGGCCTTTTGTGCGCCATGTTGATCCACCACCAATG - UNI32464 - GTAGTGGCTCTTTATGACTACACAGCCAGCCGATCAGATGAACTAA

CCATCCATCGTGGAGACATTATCCGAGTGTATTTCAAAGATAATGAAGACTGGTGGTACGGCAGCGTAAGAAAGGGGCAGGAAGGGTTCTTTCCAGCTAA

TCATGTGGCCAGTGAAA - UNI34221 - CACTGTATCGAGACTCCCCTCCGAAGGTAAAGGAGCGCTCCCCTCCTTTAACTCCCAAGGAGAAAACTA

AACCAGAAAAGCCTCTGGCTTCTCAAAAG - UNI25322 - CAGTCGCTCAGTAAGGGCAGACCCCTGGATCCCAGACTGGGCCCGCAGCCTGTGGGG

CA - UNI24209 - - UNI25322 - TTCTGAGAAGGGCAAAGATCAAAACGTGGAGGACCGAGGACACAAAGTAGATATGGAGACAAAGAAAAGCG

AGCCGGTGGTCCGCAAAGTCACCCTGATAGAG - UNI16148 - TAAAAAGCTGGAGACGAAGCAGAAGCCGCCTGATGAGTGCACATGATGTGACGT

CCACGCCAGACGGAGTTCTCGTTAGATTTTGGGTGAAAAGAAGCAGTATTTATTGACCTTAAAAATCTGAAGCAAACTTAGCTC
Translation
 - UNI17680 - MEPETPEKVDSAQEKVRGKTPTADDSDDSREKTGIEEKGELTDAYQLQVAEEMAKEIKKKIRKKLKEQLTYFPPDTLLHDDKLASE

KRKKKKKKVPVPTKPESS SPSDVCDSAVEGEQKKEGTPEDSQHMEGICSREQDVDATVPENAKPKPKKTKKKTKAV VSNDNEDTNGDGVHEITSRDSP

VHPKCLLDDDLVMGVYIHRTDRLKSDFMISHPMVKIHVVDEHTGQYVKKDDS SERPVSSYYEKDNVDYILPIMTQPYDFKKLKSRLPEWEEQVIFNENF

PYLLREFEECPKVILFFE ILDFLSMDEIKNNSEVQNQECGFRKIAWAFLK LLGANGNANINSKLRLQLYYPPTKPRSQLNVVEVFEWWSKCPRNRYPS

TLYVTVRGLKVPDC IKPSYRSMMALQEERGTPVYCERHRETSSVDTEPGLEDSKEEVKWKRLPGQ ACRIPNKHLFSLNAGERGCFCLDFSHNGRILAA

ACASRDGYPIIL - UNI11032 - LYEIPSGRFMRELCGHLNIIYDLDWSKDDRYLVTSSSDGTAR RVWKNEINSTSTFRVLPHPSFVYTAKFHPAT

RELVVTGCYDSMIRIWKIDAREDAAILVRQLDVHKSFVNSICFDDEG GHHMYSGDCIGVIVVWDTYVKVNDVQHSVRHWTINK EIKETEFRGVPISYL

EVHPNGKRLLIHTKDSTLRIMDLRI ILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYVWNPETG GEQVAMYSDLPFKSTIRDISYHPLENMV

AFCAFGQSEPILLYIYDFQV - UNI11021 - VAQQEAEMLKRYSGTLPLPGIHQSEDALCTCPKLPQQGSFQIDEFVNTENSSSRKIQLVKQRLETV

T EVIRSCAAK VNKNLSMTSPPPGPAKKPRVKQSFVLTTDEIIHQFGLPQTA - UNI33282 - AFISIERGPFVRHVDPPPM - UNI32464 - 

VVALYDYTASRSDELTIHRGDIIRVYFKDNEDWWYGSVRKGQEGFFPANHVASET - UNI34221 - TLYRDSPPKVKERSPPLTPKEKTKPEKPLAS

QK - UNI25322 - QSLSKGRPLDPRLGPQPVGH - UNI24209 - - UNI25322 - HSEKGKDQNVEDRGHKVDMETKKSEPVVRKVTLIE -

 UNI16148 - E

For any suggestions or comments, please send an email to unitrap@crg.es