Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019992 (2610016C23Rik)
Chromosomal location
Chr 10: 20067625 - 20078024 (+)
Description
RIKEN cDNA 2610016C23 gene Gene [Source:MGI Symbol;Acc:MGI:1919054]
RefSeq_peptide
NP_082206.2 
UniGene
Mm.262151 
MGI
MGI:1919054 
Uniprot/SWISSPROT
Q8VED8 
Uniprot/SPTREMBL
Q9D0I1 Q9D456 
Human Ortholog
ENSG00000146410 (FAM54A)
Omim not available
UniTrap UNI5979
Vector Insertion
Chr 10: 20067730 - 20068140
Public Clones CSH387 (baygenomics) IST15013A11 (tigm)
Private Clones OST192042 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31023
Vector Insertion
Chr 10: 20068242 - 20072629
Public Clones IST12355H12 (tigm) IST10361C4 (tigm) IST11031D2 (tigm) IST13069D5 (tigm)
IST14435F6 (tigm) IST10034E8 (tigm) IST12236B4 (tigm) IST14935H6 (tigm)
IST13102A1 (tigm) IST12973C2 (tigm) IST10818D5 (tigm) IST12677B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020167
Sequence
CGAGTCGGAAGCGGCGAGCGATTCCGGGAAGAAGCTACTCTGCGGCTGTAGGTCGCGTCCGGAGAGTTTCCCCGGCCGCCTGGCGCCGTGCAATGCCGCG

GGATG - UNI5979 - GTACCAACGAACAGCGTTTTCTTGAACTTCCTTCACCAATGTCTTTCATTCTAAATATATTAAGAAACGTGCTGGAATATTT

TGGTGTTCCCGTAGACCAG - UNI31023 - GATTTGCTGATTTGTCAAAATAAAAACTGTGGGTCAGCTCGGAGTATTGTTCGTATTATTGGGAGAA

GGCTTCCTTTAAAACCTTGCAGAAGACCTCATTTTGAG TTGATCCCGCATGTGAACTCTACGGAGTCTGATGATTATGAACTTAGGGTTCCATCTTTTG

CTGACGTTTTATGTGTGGCAAATGATGAAGAAGCCAGTTGTCTCAGATTTCG ACATAGTCTATGGCAAAAGAAGGAAGAAAGAAAAATTGCTCCTTTTT

ATCCTTCAAAACTAACTTGGGATCCATCATCACCTGGTCTAAGACAGAACAAAACAGAGACAGACGATCTGCCTGTAAATGAAGCTGCAATTAAAAAGAT

AGCTGCCCTTGAAGATGAGCTGACTTTTCTCCGGTCTCAGATTGCTGCGATTGTGGCAATGCAGGACCTGAGAGAGAGCAGAGAGACTG GTTTCATCGA

CTTGAGTGATGAACAAGTGCCGCCATCATCAGCGACCACTGGGCTGAGTGTGGAACCAGACCATGCTCCAAGTGTGGTGCTTCCTCCTCCTCCTCCCCCA

CCTCCTCCTCCTCAGTTTTCTCTGCAGCCTCCAAGTTCTCTTCCCATGCAGCCTGGATCTGCCAATACACATGACATAGATAGTCTGGCTACTGAAATGG

AAAGGCAGCTCTCAGGTGTTAAGAAGACCGATGACAGCCATCATTCAAAAAGCCAGAGACTTCGTGATGTCCCAAACATGCTGGATGTTCTGAAGGACGT

GAACAAGGTCAGACTTCGGCCTGTGGAAAGGTCACCAGGTGGCAGACCCGTTCAGAAGAGGAAGAGACGGAGTTCAGAATGGGATCCAGTGTCTTTAATA

TCTAATGCACTGAAGCAGAAGTTTGCATTTCAAGATGATTCCTTTGACAGAGAAAATAGTTCCTGGGAGTGTTCTCCGTTTTCTAGTCCTGAAACTTCAA

GG TTT
Translation
MPRDG - UNI5979 - GTNEQRFLELPSPMSFILNILRNVLEYFGVPVDQ - UNI31023 - DLLICQNKNCGSARSIVRIIGRRLPLKPCRRPHF

E LIPHVNSTESDDYELRVPSFADVLCVANDEEASCLRFR RHSLWQKKEERKIAPFYPSKLTWDPSSPGLRQNKTETDDLPVNEAAIKKIAALEDELTF

LRSQIAAIVAMQDLRESRETG GFIDLSDEQVPPSSATTGLSVEPDHAPSVVLPPPPPPPPPPQFSLQPPSSLPMQPGSANTHDIDSLATEMERQLSGVK

KTDDSHHSKSQRLRDVPNMLDVLKDVNKVRLRPVERSPGGRPVQKRKRRSSEWDPVSLISNALKQKFAFQDDSFDRENSSWECSPFSSPETSR F

For any suggestions or comments, please send an email to unitrap@crg.es