Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020009 (Ifngr1)
Chromosomal location
Chr 10: 19311816 - 19330031 (+)
Description
interferon gamma receptor 1 Gene [Source:MGI Symbol;Acc:MGI:107655]
Human Ortholog
not available
Omim not available
UniTrap UNI35404
Vector Insertion
Chr 10: 19317337 - 19321125
Public Clones IST14406G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020188
Sequence
GTCTGCGGCGGACGTGACGCCAAGGCCAGGCCACGGGCAGCGCGGGTCCCCTGTCAGAGGTGTCCCTCGCGCAGGAATGGGCCCGCAGGCGGCAGCTGGC

AGGATGATTCTGCTGGTGGTCCTGATGCTGTCTGCGAAGGTCGGGAGTGGAGCTTTGACGAGCACTGAGGATCCTGAGCCTCCCTCGG TGCCTGTACCG

ACGAATGTTCTAATTAAGTCTTATAACTTGAACCCTGTCGTATGCTGGGAATACCAGAACATGTCACAGACTCCTATTTTTACTGTACAGGTAAAGGTGT

ATTC - UNI35405 - GGGTTCCTGGACTGATTCCTGCACCAACATTTCTGATCATTGTTGTAATATCTATGAACAAATTATGTATCCTGATGTATCT

GCCTGGGCCAGAGTTAAAGCTAAGGTTGGACAAAAAGAATCTGACTATGCACGGTCAAAAGAGTTCCTTATGTGCCTAAAGG GAAAGGTCGGGCCCCCT

GGCCTGGAGATCAGGAGGAAGAAGGAAGAACAGCTCTCCGTCCTCGTATTTCACCCTGAAGTCGTTGTGAATGGAGAGAGCCAGGGAACCATGTTTGGTG

ACGGGAGCACCTGTTACACATTCGACTATACTGTGTATGTGGAGCATAACCGGAGTGGGGAG ATCCTACATACGAAACATACGGTCGAAAAAGAAGAGT

GTAATGAGACTCTGTGTGAGTTAAACATCTCAGTATCCACACTGGATTCCAGATATTGTATTTCAGTAGACGGAATCTCATCTTTCTGGCAAGTTAGAAC

AGAAAAATCGAAAGACGTCTGTATCCCTCCTTTCCATGATGACAGAAAGG ATTCAATTTGGATTCTGGTGGTTGCTCCTCTTACCGTCTTTACAGTAGT

TATCCTGGTATTTGCGTATTGGTATACTAAGAAGAATTCATTCAAGAGAAAAAGCATAATGTTACCTAAGTCCTTG CTCTCTGTGGTAAAAAGTGCCAC

GTTAGAGACAAAACCTGAATCGAAGTATTCACTTGTCACACCGCACCAGCCAGCTGTCCTAGAGAGTGAGACGGTGATCTGTGAAGAGCCCCTGTCCACA

GTGACAGCTCCAGACAGCCCCGAAGCAGCAGAACAGGAAGAACTTTCAAAAGAAACAAAGGCTCTGGAGGCTGGAGGAAGCACGTCTGCCATGACCCCAG

ACAGCCCTCCAACTCCGACACAAAGACGCAGCTTTTCCCTGTTAAGTAGTAACCAGTCAGGCCCTTGTAGCCTCACCGCCTATCACTCCCGAAACGGCTC

TGACAGTGGCCTCGTGGGATCGGGCAGCTCCATATCGGACTTGGAATCTCTCCCAAACAACAACTCAGAAACAAAGATGGCAGAGCACGACCCTCCACCC

GTGAGAAAGGCCCCCATGGCCTCCGGTTATGACAAACCGCACATGTTGGTGGACGTGCTTGTGGATGTTGGGGGGAAGGAGTCTCTCATGGGGTATAGAC

TCACAGGAGAGGCCCAGGAGCTGTCCTAAGGTCTCCCGAGGCCTGCTGGTGGTAAAGAAACTGACCTTTTAGGCAGTTTTTCTGCATTGATTTCATGAAA

GAAGCTATACATTAGCTAATACTAACCACATAGAATATCAGACTTAGATACGTGAATAAGGATCCTGTGGGCACTGCTGGGTCCACTCTGCAAATGCCAA

GACTATCAAAGGAACGTATTGTCGCTTCTGGCTCCTTCCCAGGTGGGCTAGCATCTGTGAGTTTGCCTCGGCTAGCCTTGCTTCCTACAGCCGCCACTGC

TCCTCCACCCTGATCATCTCACAGGACAGGGTGGACCGGGTTTTTTTTTTTTTTCACACACCTTTGTATATGTAAGTTCATGTATATAATATGTTTACAT

GTTTCACTTTGAACTGAAAGCTACTCAAAGCCAGCCGTAAGTCTATGGTAGAATGTGATGGAACATGTTGGTGGAAGCTTGTACAATAGAACACATTGGT

GGGAGCTTGTACATACTTTTTTATGGAGCATTACTTACGATTTTTTAAGTAAAATGTTTTGAAACC
Translation
MGPQAAAGRMILLVVLMLSAKVGSGALTSTEDPEPPSV VPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYS - UNI35405 - SGSWTDSC

TNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKG GKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTV

YVEHNRSGE ILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKD DSIWILVVAPLTVFTVVILVFAYWYT

KKNSFKRKSIMLPKSL LSVVKSATLETKPESKYSLVTPHQPAVLESETVICEEPLSTVTAPDSPEAAEQEELSKETKALEAGGSTSAMTPDSPPTPTQR

RSFSLLSSNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLPNNNSETKMAEHDPPPVRKAPMASGYDKPHMLVDVLVDVGGKESLMGYRLTGEAQELS


For any suggestions or comments, please send an email to unitrap@crg.es