Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020021 (Fgd6)
Chromosomal location
Chr 10: 93498906 - 93608083 (+)
Description
FYVE, RhoGEF and PH domain containing 6 Gene [Source:MGI (curated);Acc:Fgd6-001]
RefSeq_peptide
NP_444302.4 
UniGene
Mm.269596 Mm.420803 
MGI
MGI:1261419 
Uniprot/SWISSPROT
Q69ZL1 
Uniprot/SPTREMBL
B2RSV7 
Human Ortholog
ENSG00000180263 (FGD6)
Omim not available
UniTrap UNI20264
Vector Insertion
Chr 10: 93499056 - 93506046
Public Clones not available
Private Clones OST368584 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3598
Vector Insertion
Chr 10: 93508379 - 93536927
Public Clones BB0525 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31703
Vector Insertion
Chr 10: 93552508 - 93563146
Public Clones IST12798G2 (tigm) IST11568F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020208
Sequence
GTCCTTTGTGAGGCGCTCAGGCGGTGCGGGACGGAATGTGGGCGCTGCGGGGACTTTTGTCTTCTGCTCAAACTCTGGGGAGTGTGGACTGAACGGGAGC

CATGGACTGAGGGCGTGAGCCGCGCGGGGCAGTCATGACTTCTGCCGCGG - UNI20264 - AGCTTAAGAAGCCACCATTGGCTCCCAAGCCAAAGT

TAGTGGGGACCAATAATAAGCCACCTCCCCCTCCTATTGCACCTAAACCGGACATTGGCAGTGCTAGTGTTCCACGGTTAACGAAGAAGACCAAACCGGC

AATTGCGCCAAAACCAAAAGTCCCGACAAACTCAGTTGTTCAAGACATTAAGCATCCACCCTCAAAGAAACCTACTTTGAACCTGGAGGAAAGGGAGCCA

GAATTACCCGAGAGCACTGGCAAGTCTAATTGCAAGGATGTCAGGGATCCACACAGTGATTATATTTTACCAACGTGTTCCTGCAGTTCTGGGTGTATTC

ACGAGCCTAGGACTCGAGAAACCCAGTGTGTAGAGCAGCTTGTTTTAGAGCCTCTGGGAATGAAGGAAAATTTAGAGAATAGTAAAAATGGTGAGTCCTC

AAAAAGGGGGAGTAGCTGGGATTCAAGCAGCGAAAAGTGCCGGGGCCAGAGTGGAGTTGTTTTAAAGGCAAGCATCTTAGAAGAGAAGCTCAAAGAGGTC

CTGACGCAGCAGCGATCACCTTGTGGTTCCCCGGGGAGGCACAGAGCTCCAAAAAAACCAGAAATGAATGGTGACCATAGTTGCACCAGGCAGATCAGAA

TTGAATTTGCAGATGTGTCTTCTTCCCTGACCGGCTTTGAAAAAGTTCCCGCTCATCACAACTGCCACCCACAACTTCCTAGGGATGAATCTCAGACTCT

CAAGACTTGTCAAGATGGCAGTGCAGAGAGCCGTGGTCACACTGATTCATGTGAACCGGAGAACAAAAGAGTGGCTTCAGATGGAATTAGTCAGAAGACA

GAGGTCAAAGGTCTCGGTCCTTTAGAAATCCACTTACTACCGTATACCTCAAAGTTTCCAACTCCCAAGCCCAGGAAGACACACGCAGCTGCTCGTCTTC

GCCGCCAGAAGCATGTAGATACTCCTGGTGAAAGCACTGAAGAGCCAGGGAACTCAAACAATGGCTCTTCTTGCCTCCTGGAGGATTATTGTTTGAAAAA

CAATAAAGTCAGTGTTCTTCGTCAGAATGCTTTGTATAACCAGGGACCAGTGGACGAGGTGAGGCCAGCAAACCAGAGGGCACTGACAGGGGATTCCAAC

AGTGGCGGACAGGACTCAGTCGGCTCACAGAAAGCTGTGCAGCAGCAAACGCCTTCTTTAGATACAGATTCTAGTTTGACTTCTGACAGCAGTGGTTCTG

GCGTGTCACCTGCTGTGGACAAAGAGACTACTTACACACAGTGCAGTACTCAGCCTTTGAGCTTGCCTAAGCAAGTCACATCAGCCTGCACTGACCAGCC

ACCAGCTACCTGTAACCCGGAAGTGTCAGCTCCTCCCATACAAAAGGAATCTTCCTCCTCGAGAATCATTCCCAAAAAACCTCAAAGACACAGCTTGCCT

GCAGCAGGGGTGCTTAAAAAGGCTGCTTCGGAGGAGCTTGTAGAAAAGAGCTCTTCAGGTAAGGAGACAAATGTCGAGAAAGGTCTGCACAGAAACTACC

TTCACCATCCGGGGCCCCCAAACCATGGCGCGTCAGCATCACCCTTTGATATGCCCAACCCGACTTCAGAGAAGCCAGTGTGGAAGTTACCTCATCCTAT

TCTACCTTTTTCAGGGAGCCCAGAGGCCTTGAAACGCGTCACTTTATCCTTAAATAACGAGCCTTCCGTTTCCCTAACCAAGCCAAGAGCAAAATCCCTG

TCTGCCGTGGATGCGGACCGGTGTAACAAGCCTTGCAAAGACCCTCCGAAGAAAACTTCTTTTAAAAAGTTGATCAATGTGAAACTGTCCATTGGCTTCA

TAAAGAGCGACTTTCAGAAAATTAGGTCGAAAAGCTGCCAACACGGGGATGTCTCTGCAGGACATCCGCTCGCTAGAGAGCCAAAAGGACTTGAAAGTGA

TTGGCAAGGTTTGGCTACAGGAGAAGAGAAGAGAAGTAAGCCCACGAAGGCACATTCTGCAGAAAACTGCAGCCTGGAATCTCAAAAGGTGAAGTCCTGG

GGCCAGAGCAGTGCAGTTAACGGTCAGAGGGCGGAGTCTTTGGATGACCGGATTCTCTCCAGGCACACGTCCTGTACAGGCGACTTCGGGCCAGAGTATG

AAAATGTCCGCCATTATGAGGAGATACCCGAGTATGAGAATTTGCCCTTTGTCATGGCTGGAAGGAACACTCCGGACTTGGGATGGCAGAACTCCAGCAG

TGTGGAGGACACTGATGCAAGTCTATATGAAGTAGAAGAGCCCTACAATGCTCCAGATGGCCAGCTGCAACTTGATCCTAGACATCAGCCTTGCAG - U

NI3598 - TTCTGGAACATCCCAGGAGGGGAAGGATGCTCTCCATCTTGGCCTCAGTGACCTGCCTTCTGATGAGGAAGTCATCAATAGTTCTGATGAA

GATGATGTCAGCTCCGAGTCCAGTAAAGGCGAGCCAGACCCCCTGGAGGATAAACAG GATGAAGATGCTGGGATGAAAAGCAAAGTTCATCATATTGCC

AAGGAGATCATGAGCTCCGAGAAAGT GTTTGTGGATGTGTTAAAGCTTTTGCATATT - UNI31703 - GACTTCCGGGGTGCTGTAGCCCATGCAT

CCAGGCAGCTCGGGAAGCCCGTGATTGAGGACCGGATCCTTAACCAGATCCTGTACTACCTGCCTCAGCTGTACGAGCTCAACCGGGATCTCCTGAAGGA

ACTGGAAGAGCGAATGCTCACCTG GACAGAACAACAAAGAATTGCTGATATCTTTGTAAAGAAGGGGCCATACTTAAAAATGTATTCCACATACATCAA

AGAATTTGATAAGAACGTAGCTTTGCTGGATGAGCAGTGCAAGAAAAATCCAGGATTTGCTGCAGTTGTCAGAGAATTCGAG ATGAGCCCTCGATGTGC

CAACCTGGCCCTGAAGCACTACCTGCTAAAGCCAGTTCAGAGGATCCCTCAGTACAGGCTGCTACTGACAG ATTACTTAAAGAACCTTCTAGAAGACTC

TGTAGATCACAGAGACACCCAAG ATGCCCTGGCTGTTGTCATAGAGGTAGCTAACCATGCCAATGACACCATGAAGCAAGGG GACAACTTTCAGAAGC

TCATGCAGATTCAGTACAGCTTAAGTGGACACCATGAAATTGTGCAACCCGGGCGG GTTTTTCTTAAAGAAGGCACCCTGATGAAGCTGTCTCGGAAAG

TCATGCAGCCCCGGATGTTTTTCCTG TTTAACGATGCTCTTCTCTACACCACACCCATGCAGTCTGGGATGTACAAACTGAACAACATGCTCTCGCTGG

CTGGAATGAAG GTCAGAAAACCTACCCAGGAGGCATATCAGAACGAGTTAAAGATTGAAAGTGTAGAGCGTTCTTTCATCCTCTCAGCTAG TTCTGCC

GCAGAAAGAGATGACTGGCTGGAGGCCATATCCAGCTCCATAGAAGAGTATGCCAAGAAAAGAATCACATTCTGCCCCAGCAGGAGTCTTGACGAG GAC

TCAGAAAGGAAAGAAGAAGTTAGCCCCCTCGGGGCAAAGGCTCCCATCTGGATCCCAGACACCAGAGCCACCATGTGTATGATTTGCACAAGTGAATTCA

CCCTGACCTGGAGAAGACACCACTGCAGGGCCTGTGGGAAG ATTGTGTGCCAAGCTTGCTCATCAAACAAGTATGGCTTAGATTACCTGAAAGGGCAAC

TGGCAAGAGTGTGCGAGCACTGCTTCCAAGAGCTACAGAAATTAG ATCACCAGCTGTCGCCTAGGGTTGGGTCTCCCGGAAATCACAAGTCTCCTTCAA

GTGCCTTGTCGTCAGTCTTACATAGCATCCCGTCAGGGAGGAAGCAGAAGAAAATCCCCGCTGCTCTCAAAGAA GTGTCAGCAAACACAGAAGACTCCA

CTATGAGCGGCTACCTCTACAGATCCAAGGGCAGTAAAAAGCCATGGAAACACTTATGGTTTGTCATCAAAAACAAAGTACTCTACACATATGCTGCAAG

CGAG GACGTGGCAGCTTTGGAAAGTCAGCCTTTATTAGGCTTCACCGTCACTCTAGTCAAGGATGAGAACTCAGAGTCTAAAGTGTTTCAGCTGCTGCA

CAAAGGCATGGTGTTTTACGTATTTAAGGCAGACGATGCCCACTCCACGCAGAG GTGGATAGACGCATTTCAGGAAGGCACAGTATTGTAGCAGCACTG

GCTGCCTTTCCTCTGGGGTTCCAACGAGGTGGAGGTGCAGCAGAAAGGATTAAAAACTGCTCAAAAGCCGTGCAAGAATGAACACTGCCGAGACAAATCC

GCCCACAGTCGTTATGAGATAGATTGTTTTGTTAGGTATATATATAGTTCCTAAAAATGTTTTTCATGGATGTTATTTATTAAAATGTTGATGTTTACTT

TCTGGTCATAACTGTTTCTGAGACTCACACTGAATTCTAAAGTACTGTTTAGCGCCTGGGAACTTACTGTAATGCTGTATTCTGTGTACCATGGATGATG

TGCCGTCCACACTGCTGTCTCTGCCTTACGTCATGACACTCTGACTGATGGGAAAGCTTTGCACGTAAAGCACACATACTAAGTAGCAAATTTCCATACA

GTGGTTGGTTATAAATTACAATTTTAAAACTGCTGATGAAAATGAGTATTTTCGAGTCACTAAACTTAGGTGGAACTGTTTATATTGCAGTAGAGATGCA

CATTACCGGCTTCTACCTCAGCAACTGTGAAATGAAGTCCCAGCAGAGTCAGTACTGATAACGTTGTCCACAGCCCCCCAGACTCCCACACCCCATAGGA

TCTTGCCAGTTGGCCTCGAACTAAGTGTAGGCAAAGCATGAGCTGCAGTCTTCCTGCCTCAAACTCTAAGCAACTTGAGTCCCAGGCCTGTACCACCATG

TCCAGTCTTTATTTAAAACCGCCAGATCAGTGTCAATGTGATTTTTCTCTTCATTTTCTGAGACAGAAGCTCACTTTGGAACCCAGACTGGCCTGGAACT

TGCGTAACCCATGCCACCCTGTGACCCATGGTTTCTCAACTGCTAGGATTACATGTGTGTGCCACCAAGCTCAGTAATTAATGTCTTAAAAAACAGAATA

TAGCAGGCAACATGTTACCTAATACCCTCTATTATTCTTAAGAGTTTTGAGGCCAAGTCAGTGATGGTATTTCTATCTAAAAGGATGTCACATTTTCTGC

AACATGTATTTTACAAGTGGTTCGAAACCACTACTCTTTTTTTTTTTAAGGAAATTTTATGCTACTTTGATTCATTCCCCTTGACATTTAAAGTGTCGTC

ATCGACGTTGTCTTCCTCCTCTTCCTCCTCTTCTTCTTCCCCCTCTCTCTTCTCTTTTCCTCCCCCCCCAACCCCCGCCCCTCTTTGCCCCTTTTGAGAC

AGGGTCCTTCCAAGCAGCCCAGGCTGGCCTGAGGCTCACCGCCCCACCTCAGCTCCTACATCCTAGGACTTTAGATGAGTGCTGCCACTCGGACCTTACC

AGTCAGTGTTCCTCAGTAGTTAAGGTTCATGTTCTTAATTCTGACGTGCTTACTGTTTAACATGCAAACCCACTTGCACGTAAAGTTGTTAATTAGCAGC

AGGAGATGAAGTTATGCTTAAAGTTGCATCAGTGTTTAAATATTTTGTTCACTAAGTTTAAACTGTCAGCTAAGAGACAGGGTTATCTATAAAATATCCT

ATTAAAGGCTGCAGGCATTTCCCACTTCGTTATCTGTGATTCTTAGTGTGAGATCAGTGGTAGAGAATTATATTCTGGATACTATTTTTTCATCCTGAAC

ACATTCGTGAGGCCTTTTGGATGCCGTTTGCTGCAGATACAGCAGATCTAGAGGTAGCAGGTCCAGTTTTTCTTGGATGTCTCTGGCTATGGCATAATTT

GAAGCCCTGTGCAATTTCCCAGAACCCTATACCCTACCTTCCTTGTCACGGGGAACAAATCAGTTCTTCCAAACATATTTCAGTTGGATCACATAACCGT

TTTCCACGTGAGCGTCTGCATAGCGTTTGTTGACATAACCTGTATAGATCGGTTTTCCCCGACGGCCCTTGTTTTCTGCAGTAAGAAGCTTGATTCCTTG

AGTATTTACTGATTTTTTTTTCTAAACGATGTCAGACACCCCCACTTTGATTTCTAACACAATGGAATGGCACTGAGGAAAACAACTGGGAAGTATGTTT

TTGTTAGGCAGATACATAGTAGGCTGTGGAGGGATGGAGGAGCCTTCTATTCGAGAACCTAATGTCATCGCCATATGGGGGTATGCCTTAAACGTACTTC

CACTGTGCTCACTGTAGTCAAAAATGCTGGAATTTCCAGAAGTCAACCCTACCTCACTGCACGCCACGATCCTTAAGGATAGATACCATATTTATTCTCT

GCATTTCTCCTGGATCTTTGCAGCTTTAGTTGAATACATTGAAGACAGGCTTCCCAAAGGGGTTTTGCCTTAAGTAAGAATCTCACTGTTTTCCCAGGAC

AGCTCCTGCTGACATCTCCTTAGGGTGTCACCCTGCCTGACTCAGTACAATACCCAGCTACCCCTGATGTCGTCTCCAAAGCCCCCCTGATCCACTCTCT

CCTCACCGCCCTTCAAGCCCACATCCAGGGCAAGACTAGCACCCAGCTTTCTTCCCGTTCAAGTCTGTTTTCTTCAGGACACCACCTGGACCTCTGGGAT

CGAACTCTGAGTCTCTCTTGTCCTTACCATCTTCATTCTTCCACTGTTACACCCCCTTATGGGTGCTACAGCTTTCCCTCTGAGCTGCAGTAACACTCAC

TTGCCTGCTATGCAGTGCTATGTAGAAGGCCCTGGGTTCAAGCCCTTATCTAGGAAAACAACCGTGTTTTGTTTTGTTTTTCCTTCCCGATTACAACCCC

TCTTTCTGTGTAGTCTATTTCAGGCATTGCAAAGCAATCTGCATTACTGTAGAATTCTGATTTAATCCCAATGCCTGTGAACTTCAGTGGCATTCCCAAT

GGTTTGGCCTGCTTCAGCCTTTCTCACACCAGTCAGCCCAGCTCTGCCCCTTGTTATGTGACACTTCCCAGTGATGGGATCCTGTTCTTCTGTCCTTCAG

ACTGTTTGTGCTCTTTTCCCTGGTTCCTGTAGTCGTCAGCTCATAAACACTCTCACCATTCCTACTGCATTCTGTTCTTGAAAACACTTCGCCTTGCTCA

CTGGAGTTGGCCCACATCCAACAAGAATGTCTTACATGCAGTGGATAAATGCTTGCTTGTCTAGTTAGATGTCTCCTGTGGGTCCCTGAAAAATATCTTC

GGTACACGTGCTCTGGAGCCTATGCCACTTTTAATGTTATTTTCTAAATGAAAATCTATGGTGTTTTCCCTTCTAGGAAACGTTAGTTACTACTGGGAAA

GGATTCTAAGAAAGGAGACAGGTTTATTTACCACACAGTGAAGACAGCAGTGGTTCTGATGGGAGTTTGCCTGCTAGAAAAAAGAAGTTAAAGGTGGTAG

GAGCTTTTAAAAGACTAAATATCAAAATATCTTTTTCATGGAGCAATTTGCTGCATGTAAAAACCGATTTCAGAAAAGAAATTAATCACTTTTAATGTTT

TTCACAAAATACCTTTTTTTTACATAAAGTGATAATGGTTTGTATCTTACTGTTCATAAGATCATTTATAAATAAAAATAGCATTGTAAATAATGTTAAT

ATGTATTATAATTCATACAAAATAAATGTACTGTAATATCT
Translation
MTSAAE - UNI20264 - ELKKPPLAPKPKLVGTNNKPPPPPIAPKPDIGSASVPRLTKKTKPAIAPKPKVPTNSVVQDIKHPPSKKPTLNLEEREPE

LPESTGKSNCKDVRDPHSDYILPTCSCSSGCIHEPRTRETQCVEQLVLEPLGMKENLENSKNGESSKRGSSWDSSSEKCRGQSGVVLKASILEEKLKEVL

TQQRSPCGSPGRHRAPKKPEMNGDHSCTRQIRIEFADVSSSLTGFEKVPAHHNCHPQLPRDESQTLKTCQDGSAESRGHTDSCEPENKRVASDGISQKTE

VKGLGPLEIHLLPYTSKFPTPKPRKTHAAARLRRQKHVDTPGESTEEPGNSNNGSSCLLEDYCLKNNKVSVLRQNALYNQGPVDEVRPANQRALTGDSNS

GGQDSVGSQKAVQQQTPSLDTDSSLTSDSSGSGVSPAVDKETTYTQCSTQPLSLPKQVTSACTDQPPATCNPEVSAPPIQKESSSSRIIPKKPQRHSLPA

AGVLKKAASEELVEKSSSGKETNVEKGLHRNYLHHPGPPNHGASASPFDMPNPTSEKPVWKLPHPILPFSGSPEALKRVTLSLNNEPSVSLTKPRAKSLS

AVDADRCNKPCKDPPKKTSFKKLINVKLSIGFIKSDFQKIRSKSCQHGDVSAGHPLAREPKGLESDWQGLATGEEKRSKPTKAHSAENCSLESQKVKSWG

QSSAVNGQRAESLDDRILSRHTSCTGDFGPEYENVRHYEEIPEYENLPFVMAGRNTPDLGWQNSSSVEDTDASLYEVEEPYNAPDGQLQLDPRHQPCS -

 UNI3598 - SSGTSQEGKDALHLGLSDLPSDEEVINSSDEDDVSSESSKGEPDPLEDKQ DEDAGMKSKVHHIAKEIMSSEKV VFVDVLKLLHI - 

UNI31703 - DFRGAVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLTW WTEQQRIADIFVKKGPYLKMYSTYIKEFDKNVALLDE

QCKKNPGFAAVVREFE MSPRCANLALKHYLLKPVQRIPQYRLLLTD DYLKNLLEDSVDHRDTQD DALAVVIEVANHANDTMKQG DNFQKLMQIQYS

LSGHHEIVQPGR VFLKEGTLMKLSRKVMQPRMFFL FNDALLYTTPMQSGMYKLNNMLSLAGMK VRKPTQEAYQNELKIESVERSFILSAS SSAAER

DDWLEAISSSIEEYAKKRITFCPSRSLDE DSERKEEVSPLGAKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGK IVCQACSSNKYGLDYLKGQLA

RVCEHCFQELQKLD DHQLSPRVGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKE VSANTEDSTMSGYLYRSKGSKKPWKHLWFVIKNKVLYTYAA

SE DVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKADDAHSTQR RWIDAFQEGTVL

For any suggestions or comments, please send an email to unitrap@crg.es