Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020037 (Rfx4)
Chromosomal location
Chr 10: 84218793 - 84369281 (+)
Description
regulatory factor X, 4 (influences HLA class II expression) Gene [Source:MGI Symbol;Acc:MGI:1918387]
RefSeq_dna
NM_027689 NM_001024918 
RefSeq_peptide
NP_081965.2 NP_001020089.1 
UniGene
Mm.399220 Mm.79070 
MGI
MGI:1918387 
Uniprot/SWISSPROT
Q7TNK1 
Uniprot/SPTREMBL
B2RS52 
Human Ortholog
ENSG00000111783 (RFX4)
Omim not available
UniTrap UNI31084
Vector Insertion
Chr 10: 84277505 - 84298037
Public Clones IST11786D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26056
Vector Insertion
Chr 10: 84303662 - 84306945
Public Clones not available
Private Clones OST142539 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31297
Vector Insertion
Chr 10: 84307110 - 84321241
Public Clones IST15077B12 (tigm) IST12325E1 (tigm) IST15077A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34321
Vector Insertion
Chr 10: 84321343 - 84323242
Public Clones IST13992C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32004
Vector Insertion
Chr 10: 84323302 - 84325987
Public Clones PST21509-NL (escells) IST10483A10 (tigm) IST11589E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32613
Vector Insertion
Chr 10: 84326133 - 84331096
Public Clones IST10512G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34818
Vector Insertion
Chr 10: 84343720 - 84356944
Public Clones IST10403E2 (tigm) IST11637D4 (tigm) IST10489C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26154
Vector Insertion
Chr 10: 84358841 - 84367699
Public Clones IST12608E11 (tigm)
Private Clones OST133958 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020226
Sequence
ATGAACTGGGCTGCCTTCGGAGGGCCTGAGTTCTTCATCCCAGGAGGCATGAAGATGGAGGCAAGCTGCCCACTGGGCAGAAATTTCACAGAATG GTAC

CATTACTATGGCATAGCGGTGAAGGAGAGCTCCCAGTATTATGATGTGATGTACTCAAAGAAAGGAGCTGCCTGGGTGAGCGAGACGGGCAAGAGAGAAG

TCACCAAGCAGACGGTGGCATATTCTCCCCGGTCCAAGCTTGGGACATTGCTGCCAGACTTTCCAAACGTCAAAGACCTAAATCTGCCAGCCAGTCTTCC

TGAGGAGAAG GTGTCTACCTTTATTATGATGTACAGAACACACTGTCAGAGAATACTGGACACTGTAATAAGAGCCAACTTTGATGAG - UNI26056

 - GTTCAAAGTTTCCTTCTGCACTTTTGGCAAGGGATGCCGCCCCACATGCTGCCCGTGCTAGGCTCCTCCACGGTGGTGAACATCGTGGGTGTGTGTG

ACTCCATCCTCTACAAAGCCATCTCCGGTGTGTTGATGCCCACGGTGCTGCAGGCGTTGCCGGACAG - UNI31297 - CTTAACTCAGGTGATCCGA

AAGTTTGCCAAGCAGCTGGACGAGTGGCTGAAAGTGGCTCTCCACGATCTCCCGGAAAACCTGAGAAACATCAAATTTGAAT - UNI34321 - TATC

AAGGAGGTTTTCCCAAATCCTAAGGAGGCAAACATCGCTGAACCATCTGTGCCAG - UNI32004 - GCATCTCGAACGGTGATCCACAGTGCAGACA

TCACGTTCCAGATGCTGGAGGACTGGAGGAATGTGGACCTGAGTAGCATCACCAAGCAGACTCTGTATACCATGGAGGACTCTCGGGATGAGCACCGCAG

ACTCATCATCCAGT - UNI32613 - TGTACCAGGAGTTTGACCACCTGCTGGAGGAACAGTCCCCCATCGAGTCTTACATAGAATGGCTGGATACCA

TGGTAGACCGATGCGTTGTAAAG GTGGCTGCCAAGAGACAAGGGTCTCTGAAGAAAGTAGCCCAACAGTTCCTGCTGATGTGGTCTTGCTTTGGTACGA

GGGTGATCCGGGACATGACCTTGCACAGTGCCCCCAGCTTCG GCTTGTTTTATTGTCCAGCATCAAAGGCCACCCTCCTGGGCCAAGGCTGGGAGGCCC

CGTGTGATCTGTCAGGGACTTAGACCTGGTCACTGCTCCTGGACACAGGACCTGGACCTGGACCTGGTCACCGTGATAGGATCTTCCAAACTGCTTCTCT

ACACTCAGGAATTCTGGCTTCCCATCATCCAGAGCCTGCTAAACTTTAGGACCCTAGGTTGCCACTGTTGCTCGGGCCCTCTTCAAGCCCTGAGAACGTG

AATTTCTGTCCCTGGTCTAGGCCCAGAGAGAAGGAGGACTTGCAAGAGATTCAGTTTTCCCAGGGAGAGGGCATCCTTCTCAGCTCAGGTGTGTGCTCTT

CCCAATAAATCACCTGCCTTTCCCAGCTC
Translation
MNWAAFGGPEFFIPGGMKMEASCPLGRNFTEW WYHYYGIAVKESSQYYDVMYSKKGAAWVSETGKREVTKQTVAYSPRSKLGTLLPDFPNVKDLNLPAS

LPEEK VSTFIMMYRTHCQRILDTVIRANFDE - UNI26056 - VQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPD

S - UNI31297 - SLTQVIRKFAKQLDEWLKVALHDLPENLRNIKFEL - UNI34321 - LSRRFSQILRRQTSLNHLCQ - UNI32004 - AS

RTVIHSADITFQMLEDWRNVDLSSITKQTLYTMEDSRDEHRRLIIQL - UNI32613 - LYQEFDHLLEEQSPIESYIEWLDTMVDRCVVK VAAKRQ

GSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFG GLFYCPASKATLLGQGWEAPCDLSGT
Transcript ENSMUST00000095388
Sequence
ATGAACTGGGCTGCCTTCGGAGGGCCTGAGTTCTTCATCCCAGGAGGCATGAAGATGGAGGCAAGCTGCCCACTGGGCAGAAATTTCACAGAATG GTAC

CATTACTATGGCATAGCGGTGAAGGAGAGCTCCCAGTATTATGATGTGATGTACTCAAAGAAAGGAGCTGCCTGGGTGAGCGAGACGGGCAAGAGAGAAG

TCACCAAGCAGACGGTGGCATATTCTCCCCGGTCCAAGCTTGGGACATTGCTGCCAGACTTTCCAAACGTCAAAGACCTAAATCTGCCAGCCAGTCTTCC

TGAGGAGAAG GTGTCTACCTTTATTATGATGTACAGAACACACTGTCAGAGAATACTGGACACTGTAATAAGAGCCAACTTTGATGAG - UNI26056

 - GTTCAAAGTTTCCTTCTGCACTTTTGGCAAGGGATGCCGCCCCACATGCTGCCCGTGCTAGGCTCCTCCACGGTGGTGAACATCGTGGGTGTGTGTG

ACTCCATCCTCTACAAAGCCATCTCCGGTGTGTTGATGCCCACGGTGCTGCAGGCGTTGCCGGACAG - UNI31297 - CTTAACTCAGGTGATCCGA

AAGTTTGCCAAGCAGCTGGACGAGTGGCTGAAAGTGGCTCTCCACGATCTCCCGGAAAACCTGAGAAACATCAAATTTGAAT - UNI34321 - TATC

AAGGAGGTTTTCCCAAATCCTAAGGAGGCAAACATCGCTGAACCATCTGTGCCAG - UNI32004 - GCATCTCGAACGGTGATCCACAGTGCAGACA

TCACGTTCCAGATGCTGGAGGACTGGAGGAATGTGGACCTGAGTAGCATCACCAAGCAGACTCTGTATACCATGGAGGACTCTCGGGATGAGCACCGCAG

ACTCATCATCCAGT - UNI32613 - TGTACCAGGAGTTTGACCACCTGCTGGAGGAACAGTCCCCCATCGAGTCTTACATAGAATGGCTGGATACCA

TGGTAGACCGATGCGTTGTAAAG GTGGCTGCCAAGAGACAAGGGTCTCTGAAGAAAGTAGCCCAACAGTTCCTGCTGATGTGGTCTTGCTTTGGTACGA

GGGTGATCCGGGACATGACCTTGCACAGTGCCCCCAGCTTCG GGTCTTTTCACCTGATTCACCTGATGTTCGACGACTACGTGCTCTACTTGCTAGAAT

CTCTGCATTGTCAGGAGCGGGCCAACGAGCTCATGCGAGCCATGAAAGGAGAAGGAAGCACTG CAGAAGCCCAGGAAGAGATTATCTTGACAGAGGCTA

CCCCACCAACCCCTTCACCTGGTCCATCATTTTCTCCAGCAAAGTCTGCCACATCTGTGGAGGTGCCACCTCCCTCCTCCCCTGTCAGCAACCCATCCCC

CGAATACACTGGCCTTAGCACAGCAG GAGCGATGCAGTCATATACGTGGTCGCTAACATATACAGTAACAACGGCTGCAGGGTCACCGGCTGAGAACTC

CCAACAACTACCCTGTATGAGGAGCACCCATATGCCTTCTTCCTCCGTCACACACAGGATACCAGTCTACTCCCACAGAGAGGAGCATGG GTACACGGG

AAGCTATAACTACGGGAGCTATGGCAACCAGCATCCTCACCCACTGCAGAACCAGTATCCAGCCTTGCCTCATGACACAGCCATCTCTGGGCCTCTCCAC

TATTCCCCTTACCACAGGAGCTCTGCCCAG - UNI26154 - TACCCTTTCAATAGCCCCACTTCCAGGATGGAACCTTGTTTGATGAGCAGTACTCC

CAGGCTGCATCCTACCCCAGTGACTCCCCGATGGCCAGAGGTGCCGACTGCCAACGCATGCTACACAAGCCCATCTGTGCATTCCACGAGGTATGGAAAC

TCTAGTGACATGTACACCCCGCTGACCACGCGCAGGAATTCTGAGTATGAGCACATGCAACACTTTCCTGGCTTTGCTTACATCAACGGAGAGGCCTCCA

CTGGATGGGCTAAGTGACTGCTTTCATAGAAATCCATATTTAATATTAATAATTAATAATAATAATAAACCCAGTACCCACCCTCCAGAAGACTTTATTT

CAATACATCATAACTTGCGGGCTGACCTAAGCATCCATTCTCCTAATGAACAAGAGGATGTTCAATGTGGAGTGAATAGACTTTAGTTCAGAAACAGGAG

TCACTAAAAGTCAGTGGGATTGGGTTTCTGTAGCCAAGCCAGACTTGACTGTTTCTATAGAGCACTATCTTGGGCAGGCCAATCTGTGCCTTTCCCCTCT

GTTCCATGACCTTGCATGGCAACTACTCCTTGTATAGGGTACTTATTTTCTTGTTGACAAAGCTCTTTAGTCTTGAAGGATGGATACTGGAGCCAGAATC

TGGTTTGTGTTCTTGGACGGGCACATAATTTACCAAGAGCATTCACCTTGCCACCTGTCTGTCTGTCACCTCGCTGTACGGTTACCAGCCCTCAGACATG

TAATCCACATCCCGACTTCCTGGTGATGTCATTCCTACTTCCTGGAGTCCCTGGAAGTTTTTGAAAATGCTAAGCTCCCTGCTAAGTTCCATTCGTACCT

GCCATATTACCTGCATTGTCCTGGACTGTAAGCACTGTTGTTGAGGGACAGAAGAGGCCTGTTATATATTGCCTTTCGTTGATTGATGTCTGTAGGGACC

AGTTCTTCTCTGTACAAGGATTTGTCCTAAGTTTGCACAATGGCTAGCATCAGCAAAAGGCAGGAGAGGGTTTTCTTAAGTTCTGTGAGAAATGTGGATT

TATGGCACTAAACACTGTCCTCCACTGTGTTACTTTGCGAAGCTGGATGGAGCAGACTTTCACTTAGCAAGCACCAAGTGTGAAAACAACTGTCTGGTTT

CTTCATAAGACTAGAATACTTTCTGACACTTTGCTAGAAAAAAAAAATTCAAAGCTGTGCCTTTGAGTCTATACTATACTGTGTATGTGTGGAAATAAAA

AAAATGTATTGTACTTTGGGAAAATTTTTTCTTAGGTATTTTTTGTCAGATTTGTAGCTATTTGTGAGGTTTGTTAGAGATTAACATAGGTTTTCTTTCT

GTATTATAAGATGCACCAAGCAATTATGGTGGACCTATTACCCTATGGGTAAGAAATAAATGGAAATATGACATCGGATGTTTTAGCAAATGTTCTGTAA

ATAAAATGTTTGATCACACCACCCAGTGTGATAATCATGTCTACAGCTAAAATGGAAATAGTTTTATCTGTACAGTTGTGCAAGATATGGATGGTTTCAC

ACTCAAATAAAAAGTATTGAAATGAC
Translation
MNWAAFGGPEFFIPGGMKMEASCPLGRNFTEW WYHYYGIAVKESSQYYDVMYSKKGAAWVSETGKREVTKQTVAYSPRSKLGTLLPDFPNVKDLNLPAS

LPEEK VSTFIMMYRTHCQRILDTVIRANFDE - UNI26056 - VQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPD

S - UNI31297 - SLTQVIRKFAKQLDEWLKVALHDLPENLRNIKFEL - UNI34321 - LSRRFSQILRRQTSLNHLCQ - UNI32004 - AS

RTVIHSADITFQMLEDWRNVDLSSITKQTLYTMEDSRDEHRRLIIQL - UNI32613 - LYQEFDHLLEEQSPIESYIEWLDTMVDRCVVK VAAKRQ

GSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFG GSFHLIHLMFDDYVLYLLESLHCQERANELMRAMKGEGSTA AEAQEEIILTEATPPTPSPGPSF

SPAKSATSVEVPPPSSPVSNPSPEYTGLSTAG GAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRSTHMPSSSVTHRIPVYSHREEHG GYTGSYNYGSY

GNQHPHPLQNQYPALPHDTAISGPLHYSPYHRSSAQ - UNI26154 - YPFNSPTSRMEPCLMSSTPRLHPTPVTPRWPEVPTANACYTSPSVHSTRY

GNSSDMYTPLTTRRNSEYEHMQHFPGFAYINGEASTGWAK
Transcript ENSMUST00000060397
Sequence
TCGCCACGGCCCCATCTGACGAGCGGCCATTCATCAGGCCCGCTGGCCTATCAATGACATTGCTCCCATCGGGGCTCCTATAAAATGATGTTTTTTCCCA

TGAAACATCCGCAAACATTTTGACGGGTTTGGCTTTGCCCGACTGGATTACTGAGTGTCCCCTCGCTCGCTCGCTCGCTCTCTCGCTCTCTCCTTCAGCT

CTAGCTTCCTTCCTTCCCTCGCTTCTTCGCCTCTTTTCTTTCCACTAGTTCTTTCTTTTCCCCTTTTATCCTTTTGCCCTCTCACCCACCGTCTCCCCCT

CTCTCTCTCGCTATCCCTTCCTTCCTTATTTCTTCCCTCCCTTCCTCCCTGGGCATCTCTAGCACAGGGGATCCCCAAATATCAGGACTTTTGGGGGGCG

TCTGTGCTGTCCATGGGAAGAGCATGCATTGTGGGTTACTGGAGGAACCCGACATGGATTCCACAG AGAGCTGGATTGAAAGATGTCTCAATGAAAGCG

AGAATAAACGCTATTCCAGTCACACATCTCTGGGGAATGTGTCTAATGATGAAA ATGAGGAAAAAGAAAATAACAGAGCATCCAAGCCCCACTCCACGC

CGGCCACCCTGCAATG GCTGGAGGAAAACTATGAGATTGCTGAGGGCGTCTGCATCCCCCGCAGCGCCCTCTACATGCACTACCTGGATTTCTGTGAGA

AGAACGACACTCAGCCTGTCAATGCTGCCAGCTTTGGGAAG - UNI31084 - ATCATAAGGCAGCAGTTTCCTCAGCTAACCACCAGAAGACTCGGG

ACCCGAGGACAGTCAAA GTACCATTACTATGGCATAGCGGTGAAGGAGAGCTCCCAGTATTATGATGTGATGTACTCAAAGAAAGGAGCTGCCTGGGTG

AGCGAGACGGGCAAGAGAGAAGTCACCAAGCAGACGGTGGCATATTCTCCCCGGTCCAAGCTTGGGACATTGCTGCCAGACTTTCCAAACGTCAAAGACC

TAAATCTGCCAGCCAGTCTTCCTGAGGAGAAG GTGTCTACCTTTATTATGATGTACAGAACACACTGTCAGAGAATACTGGACACTGTAATAAGAGCCA

ACTTTGATGAG - UNI26056 - GTTCAAAGTTTCCTTCTGCACTTTTGGCAAGGGATGCCGCCCCACATGCTGCCCGTGCTAGGCTCCTCCACGGTG

GTGAACATCGTGGGTGTGTGTGACTCCATCCTCTACAAAGCCATCTCCGGTGTGTTGATGCCCACGGTGCTGCAGGCGTTGCCGGACAG - UNI31297

 - CTTAACTCAGGTGATCCGAAAGTTTGCCAAGCAGCTGGACGAGTGGCTGAAAGTGGCTCTCCACGATCTCCCGGAAAACCTGAGAAACATCAAATTT

GAAT - UNI34321 - TATCAAGGAGGTTTTCCCAAATCCTAAGGAGGCAAACATCGCTGAACCATCTGTGCCAG - UNI32004 - GCATCTCGA

ACGGTGATCCACAGTGCAGACATCACGTTCCAGATGCTGGAGGACTGGAGGAATGTGGACCTGAGTAGCATCACCAAGCAGACTCTGTATACCATGGAGG

ACTCTCGGGATGAGCACCGCAGACTCATCATCCAGT - UNI32613 - TGTACCAGGAGTTTGACCACCTGCTGGAGGAACAGTCCCCCATCGAGTCT

TACATAGAATGGCTGGATACCATGGTAGACCGATGCGTTGTAAAG GTGGCTGCCAAGAGACAAGGGTCTCTGAAGAAAGTAGCCCAACAGTTCCTGCTG

ATGTGGTCTTGCTTTGGTACGAGGGTGATCCGGGACATGACCTTGCACAGTGCCCCCAGCTTCG GGTCTTTTCACCTGATTCACCTGATGTTCGACGAC

TACGTGCTCTACTTGCTAGAATCTCTGCATTGTCAGGAGCGGGCCAACGAGCTCATGCGAGCCATGAAAGGAGAAGGAAGCACTG CAGAAGCCCAGGAA

GAGATTATCTTGACAGAGGCTACCCCACCAACCCCTTCACCTGGTCCATCATTTTCTCCAGCAAAGTCTGCCACATCTGTGGAGGTGCCACCTCCCTCCT

CCCCTGTCAGCAACCCATCCCCCGAATACACTGGCCTTAGCACAGCAG GAGCGATGCAGTCATATACGTGGTCGCTAACATATACAGTAACAACGGCTG

CAGGGTCACCGGCTGAGAACTCCCAACAACTACCCTGTATGAGGAGCACCCATATGCCTTCTTCCTCCGTCACACACAGGATACCAGTCTACTCCCACAG

AGAGGAGCATGG GTACACGGGAAGCTATAACTACGGGAGCTATGGCAACCAGCATCCTCACCCACTGCAGAACCAGTATCCAGCCTTGCCTCATGACAC

AGCCATCTCTGGGCCTCTCCACTATTCCCCTTACCACAGGAGCTCTGCCCAG - UNI26154 - TACCCTTTCAATAGCCCCACTTCCAGGATGGAAC

CTTGTTTGATGAGCAGTACTCCCAGGCTGCATCCTACCCCAGTGACTCCCCGATGGCCAGAGGTGCCGACTGCCAACGCATGCTACACAAGCCCATCTGT

GCATTCCACGAGGTATGGAAACTCTAGTGACATGTACACCCCGCTGACCACGCGCAGGAATTCTGAGTATGAGCACATGCAACACTTTCCTGGCTTTGCT

TACATCAACGGAGAGGCCTCCACTGGATGGGCTAAGTGACTGCTTTCATAGAAATCCATATTTAATATTAATAATTAATAATAATAATAAACCCAGTACC

CACCCTCCAGAAGACTTTATTTCAATACATCATAACTTGCGGGCTGACCTAAGCATCCATTCTCCTAATGAACAAGAGGATGTTCAATGTGGAGTGAATA

GACTTTAGTTCAGAAACAGGAGTCACTAAAAGTCAGTGGGATTGGGTTTCTGTAGCCAAGCCAGACTTGACTGTTTCTATAGAGCACTATCTTGGGCAGG

CCAATCTGTGCCTTTCCCCTCTGTTCCATGACCTTGCATGGCAACTACTCCTTGTATAGGGTACTTATTTTCTTGTTGACAAAGCTCTTTAGTCTTGAAG

GATGGATACTGGAGCCAGAATCTGGTTTGTGTTCTTGGACGGGCACATAATTTACCAAGAGCATTCACCTTGCCACCTGTCTGTCTGTCACCTCGCTGTA

CGGTTACCAGCCCTCAGACATGTAATCCACATCCCGACTTCCTGGTGATGTCATTCCTACTTCCTGGAGTCCCTGGAAGTTTTTGAAAATGCTAAGCTCC

CTGCTAAGTTCCATTCGTACCTGCCATATTACCTGCATTGTCCTGGACTGTAAGCACTGTTGTTGAGGGACAGAAGAGGCCTGTTATATATTGCCTTTCG

TTGATTGATGTCTGTAGGGACCAGTTCTTCTCTGTACAAGGATTTGTCCTAAGTTTGCACAATGGCTAGCATCAGCAAAAGGCAGGAGAGGGTTTTCTTA

AGTTCTGTGAGAAATGTGGATTTATGGCACTAAACACTGTCCTCCACTGTGTTACTTTGCGAAGCTGGATGGAGCAGACTTTCACTTAGCAAGCACCAAG

TGTGAAAACAACTGTCTGGTTTCTTCATAAGACTAGAATACTTTCTGACACTTTGCTAGAAAAAAAAAATTCAAAGCTGTGCCTTTGAGTCTATACTATA

CTGTGTATGTGTGGAAATAAAAAAAATGTATTGTACTTTGGGAAAATTTTTTCTTAGGTATTTTTTGTCAGATTTGTAGCTATTTGTGAGGTTTGTTAGA

GATTAACATAGGTTTTCTTTCTGTATTATAAGATGCACCAAGCAATTATGGTGGACCTATTACCCTATGGGTAAGAAATAAATGGAAATATGACATCGGA

TGTTTTAGCAAATGTTCTGTAAATAAAATGTTTGATCACACCACCCAGTGTGATAATCATGTCTACAGCTAAAATGGAAATAGTTTTATCTGTACAGTTG

TGCAAGATATGGATGGTTTCACACTCAAATAAAAAGTATTGAAATGAC
Translation
MHCGLLEEPDMDSTE ESWIERCLNESENKRYSSHTSLGNVSNDEN NEEKENNRASKPHSTPATLQW WLEENYEIAEGVCIPRSALYMHYLDFCEKND

TQPVNAASFGK - UNI31084 - IIRQQFPQLTTRRLGTRGQSK KYHYYGIAVKESSQYYDVMYSKKGAAWVSETGKREVTKQTVAYSPRSKLGTLL

PDFPNVKDLNLPASLPEEK VSTFIMMYRTHCQRILDTVIRANFDE - UNI26056 - VQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAI

SGVLMPTVLQALPDS - UNI31297 - SLTQVIRKFAKQLDEWLKVALHDLPENLRNIKFEL - UNI34321 - LSRRFSQILRRQTSLNHLCQ -

 UNI32004 - ASRTVIHSADITFQMLEDWRNVDLSSITKQTLYTMEDSRDEHRRLIIQL - UNI32613 - LYQEFDHLLEEQSPIESYIEWLDTM

VDRCVVK VAAKRQGSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFG GSFHLIHLMFDDYVLYLLESLHCQERANELMRAMKGEGSTA AEAQEEIIL

TEATPPTPSPGPSFSPAKSATSVEVPPPSSPVSNPSPEYTGLSTAG GAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRSTHMPSSSVTHRIPVYSHREE

HG GYTGSYNYGSYGNQHPHPLQNQYPALPHDTAISGPLHYSPYHRSSAQ - UNI26154 - YPFNSPTSRMEPCLMSSTPRLHPTPVTPRWPEVPTA

NACYTSPSVHSTRYGNSSDMYTPLTTRRNSEYEHMQHFPGFAYINGEASTGWAK

For any suggestions or comments, please send an email to unitrap@crg.es