Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020064 (Herc4)
Chromosomal location
Chr 10: 62706659 - 62780622 (+)
Description
hect domain and RLD 4 Gene [Source:MGI Symbol;Acc:MGI:1914595]
RefSeq_dna
NM_026101 
RefSeq_peptide
NP_080377.2 
UniGene
Mm.234437 
MGI
MGI:1914595 
Uniprot/SWISSPROT
Q6PAV2 
Human Ortholog
ENSG00000148634 (HERC4)
Omim not available
UniTrap UNI19195
Vector Insertion
Chr 10: 62706912 - 62708165
Public Clones (sanger) D125C02 (ggtc) H008C06 (ggtc) D039G08 (ggtc) D151C04 (ggtc)
D091D05 (ggtc) E043B03 (ggtc) D125F10 (ggtc) 5SE314G07 (ggtc) IST14523B2 (tigm)
Private Clones OST402258 (lexicon) OST330339 (lexicon) OST317343 (lexicon) OST215449 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15209
Vector Insertion
Chr 10: 62708197 - 62708569
Public Clones (ggtc) PST9853-NR (escells) IST14463C10 (tigm)
Private Clones OST237236 (lexicon) OST178179 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI429
Vector Insertion
Chr 10: 62708874 - 62726773
Public Clones DD0684 (sanger) (sanger) IST10559B2 (tigm)
Private Clones OST362130 (lexicon) OST282100 (lexicon) OST117981 (lexicon) OST67014 (lexicon)
OST66991 (lexicon) OST36096 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9295
Vector Insertion
Chr 10: 62726934 - 62732375
Public Clones XH061 (baygenomics) W062F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30064
Vector Insertion
Chr 10: 62732453 - 62736198
Public Clones D133D04 (ggtc) IST14992H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27695
Vector Insertion
Chr 10: 62741214 - 62745928
Public Clones IST13846B2 (tigm) IST13351D4 (tigm)
Private Clones OST53108 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5625
Vector Insertion
Chr 10: 62746090 - 62748399
Public Clones (sanger) CSI802 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8187
Vector Insertion
Chr 10: 62750758 - 62751799
Public Clones RRH224 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1866
Vector Insertion
Chr 10: 62753425 - 62761867
Public Clones AZ0190 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7549
Vector Insertion
Chr 10: 62761988 - 62766592
Public Clones RRR203 (baygenomics) XK232 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4703
Vector Insertion
Chr 10: 62777318 - 62778407
Public Clones AA0078 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18097
Vector Insertion
Chr 10: 62779551 - 62780027
Public Clones not available
Private Clones OST430406 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020258
Sequence
ATCCGGGTCGCTGACGGCTTGTCTCTCGGTCCGGAGAGTGCTGGCGGCAGCGTTTCTCGGAGGAGCCTGGGAAAGTTTCACGGGCGAGCCGGGCAGCAGA

GGCAGCGGAGCTGCGGTCGGGGACGTCGGAGGAGCCGTGGTAATCGCCGCGGCCGGCTGAAGGAGGAAGGTCTTGGGAGCTGGAGAGCCGCCCAGAGGTC

CAGGGAGCGTCCGTCCTCCATCGCTTAGGGCTCTCCCTGCCCTGAGAGACCCG - UNI19195 - ATAAGAACTTCCATTTTCTGTTGATGTGGAG -

 UNI15209 - ACATAGGGTACCTCCCAGTTTCCAGTGTTTCAGAAGGGACTTTTGTATTGAAACTGGAAGACCAAGGTCATTCCAAGCATGTTGTGCT

GGGGCAATGCATCCTATGGACAACTAGGTTTGGGAGGAATTGATGAAGAAATTGTACTAGAGCCCAGGAGAAGTGACTTTTTCGTGAACAAAAAGGTCCG

AGATGTAGGCTGTGGACTCAGGCACACTGTGTTTGTCCTGGATGATGGGACTGTGTACACATGTGGATGTAATGATCTAGGACAGCTAGGTCATGAAAAG

TCCAGAAAGAAACCAG - UNI429 - AGCAGGTTGTTGCCCTGGATGCCCAGAATATCGTAGCTGTTGCGTGTGGAGAAGCTCACACGTTAGCGCTGA

ATGACAAGGGCCAGGTGTATGCTTGGGGTCTCGACTCTGACGGACAGCTTGGCCTACAGGGATCAGAGGAATGTATCAGAGTACCCAG - UNI9295 -

 AAATATTAAAAGTCTTTCGGATATCCAGATAGTACAGGTTGCGTGTGGTTACTATCATTCGCTTGCACTTTCTAAAG - UNI30064 - CAAGTGAA

GTTTTCTGTTGGGGACAGAATAAATATGGCCAGCTGGGTCTAGGCATTGATTGTCAAAAGCAAACTTCACCACAGCTGATTAAGTCTTTGCTTGGAATAC

CATTCATGCAAGTCGCAGCAGGAGGAGCCCATAGTTTTGTACTCACCCTTTCCGGAGCTATCTTTGGATGGGGACGTAACAAATTTGGTCAGCTAGGTCT

TAATGATGAAAATG ATAGGTATGTTCCTAATTTACTAAAGTCACTAAGATCTCAGAAAATAGTTTATATTTGTTGCGGAGAAGATCATACTGCTGCATT

AACCAAG GAAGGTGGAGTGTTTACCTTTGGAGCTGGGGGCTATGGCCAGCTGGGTCATAATTCTACCAGTCATGAGATAAATCCCAGGAAAGTTTTTGA

ACTCATGGGAAGCATTGTTACTCAGGTCGCTTGTGGAAG - UNI27695 - GCAGCATACCTCTGCATTTGTTCCTTCTTCAGGACGAATTTACTCCT

TTGGTCTTGGTGGTAATGGGCAGTTGGGAACTGGTTCAACCAGCAACAGAAAAAGCCCTTTCACTGTAAAAGGAAACTGGTTTTCTTATAATGGACAGTG

TCCACAAGATATTG - UNI5625 - GTTCTGAAGACTATTTCTGTGTCAAAAGAATTTTCTCAGGTGGAGATCAAAGCTTTTCACATTACTCTAGTCC

TCAG AACTGTGGACCTCCAGATGACTTTAGATGCTCCGACCCTTCCAAGCAGATCTGGACAGTGAACGAAGCTCTGATTCAGAAATGGCTCAGCTACCC

CTCTGGAAGGTTCCCTGTGGAGATAGCCAA TGAGATAGATGGAACATTTTCTTCATCTGGCTGCCTAAATGGAAGTTTTCTGGCTATTAG CAATGACG

ATCACTATAGAACAGGTACCAGATTTTCAGGGGTTGATATGAACGCTGCTAGACTCTTATTCCACAAACTTATACAACCTGATCATCCTCAGATATCTCA

GCAG - UNI8187 - GTGGCAGCTAGTTTGGAAAAGAATCTAATCCCTAAACTGACTAGTTCCCTACCTGATGTTGAAGCTCTGAGGTTTTATCTTAC

CCTGCCAGAGTGTCCCCTGATGAGTGACTGCAACAATTTCACAACAATAGCAATCCCCTTTGGTACAGCTCTTGTGAACCTAGAAAAGGCACCACTGAAA

GTACTTG AAAACTGGTGGTCAGTACTTGAACCTCCACTATTCCTCAAGATAGTAGAACTTTTTAAGGAAGTTGTGGTACATCTTTTGAAACTCTACAAG

ATCGGCATTCCCCCTTCTGAAAGAAGAATTTTCAACAGTTTTCTTCATACCGCATTAAAGGTTTTAGAAATATTGCATAGG - UNI1866 - GTAAAT

GAGAAAACAGGACAACTTATTCAATATGACAAGTTTTACATCCATGAAGTCCAAGAGCTGATAGACATAAGGAATGACTATATCAACTGGGTCCAGCAGC

AAGCCTATGGAGTG - UNI7549 - TTGGCAGATATCCCGGTGACAATTTGTACATATCCATTTGTATTTGATGCCCAGGCAAAAACTACTCTGCTCC

AGACAGATGCAGTCTTGCAGATGCAG ATGGCCATTGACCAGGCCCACAGGCAGAATGTCTCCTCTCTTTTTCTCCCAGTGATCGAGTCTGTGAATCCTT

GCTTAATTCTAGTTGTTCGCAGAGAGAATATTGTAGGAGATGCGATGGAAGTCCTCAGGAAAACCAAGAATATAGATTATAAAAAGCCACTCAAG GTTA

TATTTGTTGGAGAAGATGCTGTTGATGCAGGAGGTGTTCGCAAAGAATTTTTCTTGCTTATCATGAGGGAATTGTTGGATCCTAAATACGGCATGTTTCG

ATATTATGAAGATTCCAGGCTCATTTGGTTTTCAGATAAG ACATTTGAAGACAGTGATTTGTTCCACTTGATCGGTGTTATCTGTGGATTAGCAATTTA

TAATTTTACCATTGTGGACCTCCATTTCCCTTTGGCTTTATATAAGAAACTGCTGAAAAGGAAGCCGTCCCTGGATGATCTGAAAGAGCTGATGCCAGCC

GTCGGGAG AAGCATGCAGCAATTGCTGGACTATCCAGAAGATGACATAGAGGAAACATTTTGTCTAAACTTTACG ATCACAGTTGAGAACTTCGGTGC

AACAGAAGTAAAAGAGCTGGTTCTGAACGGGGCAGACACTGCTGTTAATAGACAGAATCG - UNI4703 - GCAGGAGTTTGTTGATGCCTATGTGGA

TTACATATTCAATAAATCAGTGGCATCTTTATTTGATGCTTTCCATGCGGGCTTTCATAAGGTCTGTGGAGGAAAAGTTCTTCTGCTCTTCCAGCCTAAT

GAATTACAAGCTATGGTTATTGGGAATACAAATTATGATTGGAAAGAACTGGAGAAG AATACAGAATACAAAGGAGAGTATTGGGCAGACCATCCCACG

ATAAAAATTTTTTGGGAAGTGTTTCATGAATTACCACTAGAGAAGAAGAAACAATTTCTAT - UNI18097 - TATTTTTGACAGGTAGTGATCGGAT

TCCCATTCTTGGTATGAAGAGTCTGAAACTAGTCATCCAGTCAACAGGAGGTGGTGAGAGCTATCTCCCGGTTTCCCATACCTGTTTTAATCTTCTAGAT

CTCCCAAAATATACAGAGAAAGAAACCCTCCGATGTAAACTGATCCAAGCTATTGATCACAATGAAGGCTTCAGTTTAATATGACCTTGGACTTTTCTGT

TTAGTACAAAAACCACTCGTGTTTCTCTTGTGAATTCAGCACAGTGAGAGTTACTTCTGTAATTCTTACTTATAAATTGTTCACTACTGTACTGATGAAA

GCCCAAAATTAAAAACTGTGCATTAATACTAAACTGTACAGAACCATGAATTGTCCATCCTCATACAAGTATTGTGAATACATTAAAGTTTTACTCACAG

GAATTTTAAGAGTTTGCATATTTCGGAAATTACCTGATGTGTGGGTGCATGGAAATGTTGCTTACTGTTTCTTCAATCACTGGGGGGAAAGACTACGATG

GCCTGCCCACAGTCATTTGATTATTTTTCCATTTTGTAAATAAAAATTTTGTAATAAAATAGTGACATTC
Translation
 - UNI19195 -  - UNI15209 - MLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR

KKPE - UNI429 - EQVVALDAQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPR - UNI9295 - RNIKSLSDIQIVQVACG

YYHSLALSKA - UNI30064 - ASEVFCWGQNKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND 

DRYVPNLLKSLRSQKIVYICCGEDHTAALTK EGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQVACGR - UNI27695 - RQHTSAFVPS

SGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWFSYNGQCPQDIG - UNI5625 - GSEDYFCVKRIFSGGDQSFSHYSSPQ NCGPPDDFRCSDPSK

QIWTVNEALIQKWLSYPSGRFPVEIAN NEIDGTFSSSGCLNGSFLAIS SNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQQ - UNI8187 -

 VAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDCNNFTTIAIPFGTALVNLEKAPLKVLE ENWWSVLEPPLFLKIVELFKEVVVHLLKLYKIGI

PPSERRIFNSFLHTALKVLEILHR - UNI1866 - VNEKTGQLIQYDKFYIHEVQELIDIRNDYINWVQQQAYGV - UNI7549 - LADIPVTICT

YPFVFDAQAKTTLLQTDAVLQMQ MAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLK VIFVGEDAVDAGGVRKEFF

LLIMRELLDPKYGMFRYYEDSRLIWFSDK TFEDSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKRKPSLDDLKELMPAVGR RSMQQLLDYPEDD

IEETFCLNFT ITVENFGATEVKELVLNGADTAVNRQNR - UNI4703 - RQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAM

VIGNTNYDWKELEK NTEYKGEYWADHPTIKIFWEVFHELPLEKKKQFLL - UNI18097 - LFLTGSDRIPILGMKSLKLVIQSTGGGESYLPVSHT

CFNLLDLPKYTEKETLRCKLIQAIDHNEGFSLI
Transcript ENSMUST00000092452
Sequence
ATCCGGGTCGCTGACGGCTTGTCTCTCGGTCCGGAGAGTGCTGGCGGCAGCGTTTCTCGGAGGAGCCTGGGAAAGTTTCACGGGCGAGCCGGGCAGCAGA

GGCAGCGGAGCTGCGGTCGGGGACGTCGGAGGAGCCGTGGTAATCGCCGCGGCCGGCTGAAGGAGGAAGGTCTTGGGAGCTGGAGAGCCGCCCAGAGGTC

CAGGGAGCGTCCGTCCTCCATCGCTTAGGGCTCTCCCTGCCCTGAGAGACCCG - UNI19195 - ATAAGAACTTCCATTTTCTGTTGATGTGGAG -

 UNI15209 - ACATAGGGTACCTCCCAGTTTCCAGTGTTTCAGAAGGGACTTTTGTATTGAAACTGGAAGACCAAGGTCATTCCAAGCATGTTGTGCT

GGGGCAATGCATCCTATGGACAACTAGGTTTGGGAGGAATTGATGAAGAAATTGTACTAGAGCCCAGGAGAAGTGACTTTTTCGTGAACAAAAAGGTCCG

AGATGTAGGCTGTGGACTCAGGCACACTGTGTTTGTCCTGGATGATGGGACTGTGTACACATGTGGATGTAATGATCTAGGACAGCTAGGTCATGAAAAG

TCCAGAAAGAAACCAG - UNI429 - AGCAGGTTGTTGCCCTGGATGCCCAGAATATCGTAGCTGTTGCGTGTGGAGAAGCTCACACGTTAGCGCTGA

ATGACAAGGGCCAGGTGTATGCTTGGGGTCTCGACTCTGACGGACAGCTTGGCCTACAGGGATCAGAGGAATGTATCAGAGTACCCAG - UNI9295 -

 AAATATTAAAAGTCTTTCGGATATCCAGATAGTACAGGTTGCGTGTGGTTACTATCATTCGCTTGCACTTTCTAAAG - UNI30064 - CAAGTGAA

GTTTTCTGTTGGGGACAGAATAAATATGGCCAGCTGGGTCTAGGCATTGATTGTCAAAAGCAAACTTCACCACAGCTGATTAAGTCTTTGCTTGGAATAC

CATTCATGCAAGTCGCAGCAGGAGGAGCCCATAGTTTTGTACTCACCCTTTCCGGAGCTATCTTTGGATGGGGACGTAACAAATTTGGTCAGCTAGGTCT

TAATGATGAAAATG ATAGGTATGTTCCTAATTTACTAAAGTCACTAAGATCTCAGAAAATAGTTTATATTTGTTGCGGAGAAGATCATACTGCTGCATT

AACCAAG GAAGGTGGAGTGTTTACCTTTGGAGCTGGGGGCTATGGCCAGCTGGGTCATAATTCTACCAGTCATGAGATAAATCCCAGGAAAGTTTTTGA

ACTCATGGGAAGCATTGTTACTCAGGTCGCTTGTGGAAG - UNI27695 - GCAGCATACCTCTGCATTTGTTCCTTCTTCAGGACGAATTTACTCCT

TTGGTCTTGGTGGTAATGGGCAGTTGGGAACTGGTTCAACCAGCAACAGAAAAAGCCCTTTCACTGTAAAAGGAAACTGGTTTTCTTATAATGGACAGTG

TCCACAAGATATTG - UNI5625 - GTTCTGAAGACTATTTCTGTGTCAAAAGAATTTTCTCAGGTGGAGATCAAAGCTTTTCACATTACTCTAGTCC

TCAG AACTGTGGACCTCCAGATGACTTTAGATGCTCCGACCCTTCCAAGCAGATCTGGACAGTGAACGAAGCTCTGATTCAGAAATGGCTCAGCTACCC

CTCTGGAAGGTTCCCTGTGGAGATAGCCAA TGAGATAGATGGAACATTTTCTTCATCTGGCTGCCTAAATGGAAGTTTTCTGGCTATTAG CAATGACG

ATCACTATAGAACAGGTACCAGATTTTCAGGGGTTGATATGAACGCTGCTAGACTCTTATTCCACAAACTTATACAACCTGATCATCCTCAGATATCTCA

GCAG - UNI8187 - GTGGCAGCTAGTTTGGAAAAGAATCTAATCCCTAAACTGACTAGTTCCCTACCTGATGTTGAAGCTCTGAGGTTTTATCTTAC

CCTGCCAGAGTGTCCCCTGATGAGTGACTGCAACAATTTCACAACAATAGCAATCCCCTTTGGTACAGCTCTTGTGAACCTAGAAAAGGCACCACTGAAA

GTACTTG AAAACTGGTGGTCAGTACTTGAACCTCCACTATTCCTCAAGATAGTAGAACTTTTTAAGGAAGTTGTGGTACATCTTTTGAAACTCTACAAG

ATCGGCATTCCCCCTTCTGAAAGAAGAATTTTCAACAGTTTTCTTCATACCGCATTAAAGGTTTTAGAAATATTGCATAGG - UNI1866 - GTAAAT

GAGAAAACAGGACAACTTATTCAATATGACAAGTTTTACATCCATGAAGTCCAAGAGCTGATAGACATAAGGAATGACTATATCAACTGGGTCCAGCAGC

AAGCCTATGGAGTG - UNI7549 - GATGTCAGCCATGGAGTAACTGAG TTGGCAGATATCCCGGTGACAATTTGTACATATCCATTTGTATTTGAT

GCCCAGGCAAAAACTACTCTGCTCCAGACAGATGCAGTCTTGCAGATGCAG ATGGCCATTGACCAGGCCCACAGGCAGAATGTCTCCTCTCTTTTTCTC

CCAGTGATCGAGTCTGTGAATCCTTGCTTAATTCTAGTTGTTCGCAGAGAGAATATTGTAGGAGATGCGATGGAAGTCCTCAGGAAAACCAAGAATATAG

ATTATAAAAAGCCACTCAAG GTTATATTTGTTGGAGAAGATGCTGTTGATGCAGGAGGTGTTCGCAAAGAATTTTTCTTGCTTATCATGAGGGAATTGT

TGGATCCTAAATACGGCATGTTTCGATATTATGAAGATTCCAGGCTCATTTGGTTTTCAGATAAG ACATTTGAAGACAGTGATTTGTTCCACTTGATCG

GTGTTATCTGTGGATTAGCAATTTATAATTTTACCATTGTGGACCTCCATTTCCCTTTGGCTTTATATAAGAAACTGCTGAAAAGGAAGCCGTCCCTGGA

TGATCTGAAAGAGCTGATGCCAGCCGTCGGGAG AAGCATGCAGCAATTGCTGGACTATCCAGAAGATGACATAGAGGAAACATTTTGTCTAAACTTTAC

G ATCACAGTTGAGAACTTCGGTGCAACAGAAGTAAAAGAGCTGGTTCTGAACGGGGCAGACACTGCTGTTAATAGACAGAATCG - UNI4703 - GC

AGGAGTTTGTTGATGCCTATGTGGATTACATATTCAATAAATCAGTGGCATCTTTATTTGATGCTTTCCATGCGGGCTTTCATAAGGTCTGTGGAGGAAA

AGTTCTTCTGCTCTTCCAGCCTAATGAATTACAAGCTATGGTTATTGGGAATACAAATTATGATTGGAAAGAACTGGAGAAG AATACAGAATACAAAGG

AGAGTATTGGGCAGACCATCCCACGATAAAAATTTTTTGGGAAGTGTTTCATGAATTACCACTAGAGAAGAAGAAACAATTTCTAT - UNI18097 - 

TATTTTTGACAGGTAGTGATCGGATTCCCATTCTTGGTATGAAGAGTCTGAAACTAGTCATCCAGTCAACAGGAGGTGGTGAGAGCTATCTCCCGGTTTC

CCATACCTGTTTTAATCTTCTAGATCTCCCAAAATATACAGAGAAAGAAACCCTCCGATGTAAACTGATCCAAGCTATTGATCACAATGAAGGCTTCAGT

TTAATATGACCTTGGACTTTTCTGTTTAGTACAAAAACCACTCGTGTTTCTCTTGTGAATTCAGCACAGTGAGAGTTACTTCTGTAATTCTTACTTATAA

ATTGTTCACTACTGTACTGATGAAAGCCCAAAATTAAAAACTGTGCATTAATACTAAACTGTACAGAACCATGAATTGTCCATCCTCATACAAGTATTGT

GAATACATTAAAGTTTTACTCACAGGAATTTTAAGAGTTTGCATATTTCGGAAATTACCTGATGTGTGGGTGCATGGAAATGTTGCTTACTGTTTCTTCA

ATCACTGGGGGGAAAGACTACGATGGCCTGCCCACAGTCATTTGATTATTTTTCCATTTTGTAAATAAAAATTTTGTAATAAAATAGTGACATTC
Translation
 - UNI19195 -  - UNI15209 - MLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR

KKPE - UNI429 - EQVVALDAQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPR - UNI9295 - RNIKSLSDIQIVQVACG

YYHSLALSKA - UNI30064 - ASEVFCWGQNKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND 

DRYVPNLLKSLRSQKIVYICCGEDHTAALTK EGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQVACGR - UNI27695 - RQHTSAFVPS

SGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWFSYNGQCPQDIG - UNI5625 - GSEDYFCVKRIFSGGDQSFSHYSSPQ NCGPPDDFRCSDPSK

QIWTVNEALIQKWLSYPSGRFPVEIAN NEIDGTFSSSGCLNGSFLAIS SNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQQ - UNI8187 -

 VAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDCNNFTTIAIPFGTALVNLEKAPLKVLE ENWWSVLEPPLFLKIVELFKEVVVHLLKLYKIGI

PPSERRIFNSFLHTALKVLEILHR - UNI1866 - VNEKTGQLIQYDKFYIHEVQELIDIRNDYINWVQQQAYGV - UNI7549 - DVSHGVTE L

ADIPVTICTYPFVFDAQAKTTLLQTDAVLQMQ MAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLK VIFVGEDAVD

AGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDK TFEDSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKRKPSLDDLKELMPAVGR RSMQ

QLLDYPEDDIEETFCLNFT ITVENFGATEVKELVLNGADTAVNRQNR - UNI4703 - RQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLL

FQPNELQAMVIGNTNYDWKELEK NTEYKGEYWADHPTIKIFWEVFHELPLEKKKQFLL - UNI18097 - LFLTGSDRIPILGMKSLKLVIQSTGGG

ESYLPVSHTCFNLLDLPKYTEKETLRCKLIQAIDHNEGFSLI

For any suggestions or comments, please send an email to unitrap@crg.es