Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020067 (Mypn)
Chromosomal location
Chr 10: 62578543 - 62666700 (-)
Description
myopalladin Gene [Source:MGI Symbol;Acc:MGI:1916052]
UniGene
Mm.259767 
MGI
MGI:1916052 
Uniprot/SWISSPROT
Q5DTJ9 
Human Ortholog
ENSG00000138347 (MYPN)
Omim not available
UniTrap UNI34965
Vector Insertion
Chr 10: 62655134 - 62666701
Public Clones IST10307D4 (tigm) IST10245F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13763
Vector Insertion
Chr 10: 62632179 - 62655134
Public Clones (sanger) CMHD-GT_268G7-3 (cmhd) CMHD-GT_452B3-3 (cmhd) CMHD-GT_534H12-5S (cmhd)
CMHD-GT_534H12-3 (cmhd) PST13878-NR (escells) IST12522H7 (tigm) IST12762H5 (tigm)
IST12681A12 (tigm) IST12357B2 (tigm) IST10318A12 (tigm) IST11747H2 (tigm)
IST13331E1 (tigm) IST12322H5 (tigm) IST11760H3 (tigm) IST14758E2 (tigm)
IST12032D12 (tigm) IST11753E3 (tigm) IST11824E9 (tigm) IST12259D4 (tigm)
IST12297A3 (tigm) IST11101A7 (tigm) IST12304D7 (tigm) IST13025D2 (tigm)
IST12205H8HMR1 (tigm) IST12801E6 (tigm) IST11617F9 (tigm) IST12399A4 (tigm)
IST11746F12 (tigm) IST11395D8 (tigm)
Private Clones OST450195 (lexicon) OST417962 (lexicon) OST411828 (lexicon) OST394723 (lexicon)
OST353225 (lexicon) OST349014 (lexicon) OST316710 (lexicon) OST298008 (lexicon)
OST290832 (lexicon) OST245063 (lexicon) OST182102 (lexicon) OST155079 (lexicon)
OST98813 (lexicon) OST84423 (lexicon) OST36496 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22021
Vector Insertion
Chr 10: 62630033 - 62632002
Public Clones not available
Private Clones OST311329 (lexicon) OST240702 (lexicon) OST133825 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22468
Vector Insertion
Chr 10: 62626373 - 62629980
Public Clones CMHD-GT_437G8-3 (cmhd)
Private Clones OST296252 (lexicon) OST187116 (lexicon) OST170690 (lexicon) OST83588 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24302
Vector Insertion
Chr 10: 62615685 - 62624969
Public Clones not available
Private Clones OST225132 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095580
Sequence
CTGAGAGCTGACAAATGCTCTGGCCGCGGCGGTGACGGTTGCCCAGCTTCTAACAGCCATCCTCACCAAAACTACGGTTAACTCCTCGCTCTCTATGGAC

AGCCACTCTCTCTCTCCAAGGGCGTGAAGACTTTTCCCTTTCTCCAGCGTTTTCATCCAAACCTGCTCCTTGGATAACTACCGTCACAGAAGCTTGCCTG

GGTTGGACATCGTTGGGTCACCTAAAAAAAGAAAG CATGCAAGAAGACAGCATAGAGGCATCCACTTCCATCTCTCAACTCCTGAGAGAAAGTTACCTG

GCTGAAACCAGACATCGTGGGGACAACGAGCGAAGTCGAGCTGAGCCCTCCTCCAACCCTTTCCATTTCAGTGGTCCTGGGGCTGCAGAGGGAGGAGGCC

CAGAGGACCTTCCGGACCTTTCTGCCTTCCTGAGCCAAGAGGAGTTAGATGAAAGTGTCAATCTGGCGAGGCTGGCCATCAACCACGACCCCTTGGAGAG

AGTGGATGAAGCTCAAGCCAGGAAGCGTCTGTCTTCCGACCAGACGAAGCATGCATCCAAGCCAAGCTTCGAACCTGCCTTCCACCAGGACAGCTCCCGA

GGTCCGGCCAGTCCTAAAGACAGCCCGCCAGAGACCAAGAGGCCGCAGTACAGTTCTGAAACCCAGTCCAAGAAAGTTTTCCTGAACAAGGCTGCCGATT

TCATCGAAGAACTTTCCTCCCTTTTCAAGGCTCACAGCTCCAAGAGGATCAGACCTCGGGCCTGCAAAAACCACAAGAGCAAGACGGAATCCCAAAACAA

AGTTCTGCAGGAAAACAGCCCCACTTTCTCAGATCTAACAGAAAGGCGAGAGAGAGCATCGGTCCCCATTCCCATCCCTGCGGACAGCAGGGATAACGAG

CTGAACCACGCTATTGAACAGCGAGAAGCCAAGAGGAGGGAAGCCGAGTTGGCTGCGGGGGAGGCTGCGGCTGGAGACAGCACCCCTGGCTCTTCGCCTT

CATCCCTATACTACGAAGAGCCTCTGGGGCAGCCTCCCCGCTTCACACAAAAGTTACGGAGCCGAGAAGTTCCGGAAGGCAGCCGAGTCCAGTTGGATTG

TATAGTGGTAGGAATTCCACCGCCCCAAGTAAG - UNI13763 - GTGGTATTGTGAAGGCAAGGAGCTTGAAAACTCTCCAGATATCCACATTGTGC

AGGCAGGAAACCTTCACTCACTGACCATCGCCGAGGCCTTCGAAGAGGACACAGGACGATACTCATGCTTTGCTTCCAACATTTATGGGACAGATTCAAC

TTCCGCTGAGATTTACATAGAAG - UNI22021 - GAGTCTCTTCCTCTGACTCAGAAGGGGACCCTAACAAAGAAGAGATGAATCG - UNI22468

 - AATCCAGAAGCCAAATGAGGTGTCCTCACCTCCCACCACCTCTGCAGCCATTCCTCCAGCAGCAGAAGCCCAGCCTTTGGCGGCCCAGCCCAGAGTG

TCCACCGTCCAGCAG TGTCAGAGTCCTACCAACTATTTGCAAGGCCTGAACGGGAAGCCCATCATTGCAGCGCCAGTGTTTACGAAG - UNI24302 

- ATGCTGCAGAACTTGTCAGCCTCTGAGGGGCAGCTGGTTGTCTTTGAGTGCAGAGTGAAAGGGGCCCCATCTCCGAAAGTCGAGTGGTACAGAGAAGG

GACATTAATAGAAGACTCTCCCGACTTCAGGATCTTACAGAAGA AACCTCGATCCATGGCAGAACCAG AGGAGATCTGCACGTTAGTCATTGCTGAGG

TGTTTTCGGAAGACTCGGGATGCTTCACGTGCACCGCAAGCAACAAATATGGCACCGTGTCTAGCATCGCACAGTTAGACGTGAGAG GAAATGAAGACA

TCAGTGATAATGGAGCTCTTCACTCAGCAAATTCAACCACCAACCCGGCTGTGGCTGAGCACCAGCCTTCCCCACTCAACCCACAGCCTCTTTCAGAGGA

GCAGCCCCCAAAACCCAAACTTGAAGGGGTTCTGGTGAACCATAATGAGCCCCGGTCCAGCTCCAGGATTGGGCTACGGGTGCACTTCAACCTACCGGAA

GACGACAAAGATATGGAGGCATCCTCTGGGAGCGGTGCGGCCAATACCAGCCAGACTAGACCGAATTCCTTCCCCGAGAGGTTCAATGGACAGGAAGCCA

GAATCCCAGAGCCTTCCTCACCTATCAAGGAGCCCCCTCCGGTCCTGGCCAAACCCAAACT TGACTCCACTCAGTTACAACAGCTTCATAACCAAGTGT

TACTGGAACAGCAGCAACTGCAAAACACATCTCCTTCATCACCCAAGGAGTCTCTTCACATGAGTGCCTTGAACTCGGCTCCCCCGGCAGTGACCATCTC

CAGCAAGCAGGTGAAGGGTCCTGCGCCTCAGATGTTCAACCTGGCCCGGCCGAAGCACTTCTTCCCCGCTTCAAGCACTTCCACAGCAACCGTGTCCCCA

TCCAGCTCCCCGGTGTTCACCTTGAGCAATACTCCTCAAACAATTCAGAGGACAGTCAGCAAAGAAAGCCTCTTAATGGCCCACCCCTCCACACAAGGCA

GATCTCCTGGCGGGCTCTCCATCCAAAATGAGCCAGCTCCTCCAAGCCCAGCAGAGCCAGCAGCGCCACCAACAGCCGCCTATTCCATCCCTAGCGGAAA

CCAGTTTCAGCCTCACTGCGTATCCCCCACTCCTGTCTCCCCTACCGGTCGGATTCAGAACCCGGTGGCTTTTCTTAGCTCTGTTCTGCCTTCTCTCCCT

TCCATTCCACCCACCAACGCCATGGGGCTGCCTAAAAGCGCACCATCTGT ACCATCCCAGGGTCTAATGAAGAAAACCACAAAGGCCCCTCAGGCAGTG

AGTGACGACTACATCCGAGAGACGAAGAACTCAGTGATTCTAGACTTGGGGAAGAAAGTGAATTTCGGTGACGTCAGATCACACCAGCAG GAATATAAA

ATTTCCAGCTTTGAGCAGAGGCTGATGAACGAGATAGAGTTCCGCCTGGAGCGGACTCCTGTTGACGAATCTGATGACGAGATAGAACACGACGAAATCC

CCACGGGCAAGTGCATCGCGCCCATCTTTGACAAAAGGCTCAAGCACTTCCGGGTTACCGAAGGCTCACCAGTCACCTTCACCTGCAAAATTGTTGGGAT

ACCTGTTCCAAAG GTTTATTGGTTCAAAGACGGGAAGCAGATTTCTAAGAGAAATGAGCACTGTAAAATGAGGAGAGAAGGGGATGGGACCTGCTCACT

ACACATTGAGTCCACCCACGGCGATGATGACGGCAACTACACCATCATGGCCGCCAACCCCCAG GGGAGAATCAGCTGTTCTGGCCATTTGATGGTACA

GGGTTTGCCCATTCGAAGCCGACTCAGCCCTGCTCTGTCTCACAG AGGAAGGTCCAGAATGCAGGAAAGAGACAAAGAGCCGCTACAGGAACGCTTTTT

CCGACCACATTTCCTGCAGGCCCCTGGGGATATGGTGGCTCACGAGGGCCGCCTCTGTCGGCTGGACTGTAAG GTGAGTGGCTTACCACCCCCGGAGCT

GACATGGCTACTCAATGGGCAACCTGTGCTACCCGACGCCTCCCACAAGATGCTGGTCAGAGAGACGGGAGTCCACTCTCTGCTCATCGACCCGCTCACC

CAACGAGACGCAGGGACCTACACGTGCGTGGCTACCAACAAAACCGGGCAGAATTCCTTTAGTCTGGAGCTCACTGTGGTAG CCAAAGAGGTAAAGAAG

GCGCCAGTGATCCTGGAGAAACTCCAGAACAGCGGCGTCCCTGAGGGCCACCCGGTGCGACTGGAGGGCCGGGTCATAGGCATGCCCCCGCCTGTGTTCT

ACTGGAAGAAAGACAACGAGACCATCCCGTTCACTAGAGAGAGGATCAG CATGCACCAGGATACAACAGGCTATGTCTGCCTCCTCATCCAGCCAGCCA

AGAAGTCCGACGCTGGGTGGTACACACTGTCAGCCAAGAACGAAGCCGGCATCGTATCGTGCACAGCTAGGTTGGATATATATG CTCAGTGGCACCAGC

AAATCCCAACACCCATATCTATCCGGCCCAGCGGCAGCCGCTACGGGTCTCTCACCAGCAAAGGCCTCGACATCTTTTCTGCCTTCTCCTCCGTGGAAAG

CACGATGCTGTATTCCTGTACTTCTCGGAGTGTAGTGGAGAGCGATGAACTTTAAGGCTGCCTGGGTGCCTGCTTTGTAAGAGGGTGGACTGTGGAGGGG

TAGGAAGACGACTGACCGTATGCAGTGGTTTCCAAACAACTGGATTGGAGTGAGTTTCCATCCTGCGGGACCCGTGGCAAGAAGTGTTTTAAGTAAGTTG

GCTGGGGCTTTTTGAGCCTTGGCTGAGGGCTGTGCGTCTTCAAGATGCCAGCCAGTAGACAATATACCCAAACCAAAGACACCGCACCACCACCACCACA

GCTTTTGGTGGGGGATAGGGAGCTAGCATGCTCCCCCACCCGGTGTGTTAGGGATGCTAGGCCCAACTAGGAGCAATTAGGAGCCATAGCGAGGGCTGAG

AGAAGTTAGCAACCTTAGGATAGAAACAAAGGAGGAAGATGGAGAGCCCGTTGTCACCTTTCGTGGGTTACATCCATCCCCGTCATCCTGGTGAATTCAT

TAAATGAGCCCCTGCTTAGCATTAGAGGATCTTGCCATACGCCCCACCCCACCCCCAGTGGCAAAACACTTACTTTGCATTATCCTACCTGTGGAGTCAC

GTAATAAGAAGCCAAAATGTGCCTGAGATTTAAAGAGAAAACAAAAAACAAAACGGGAGAGGGTTTCCTAGGACACTCAGATTTCCCACTCCGCTGGTTA

CGTGCTCAAAGCGGTTCCCGCCAGCCTATCAGCGCCATTTTAGGCAGAAAACCACACCCACCTCCATCCCGAGTGCCTGGATGGGTACCGAGCTTAATGG

ACACCTTTGAAATAGACCTGCTGGGTAATAACTCCGAGACTGAACTACCATTTGGTGTCTACCGTTCTTAGCCTGTCCAAACATGGCCCCGGGGATGGTT

GTCACAGCGGCTTGCTGCAGGCAAGCCAGGGCTATGAACTGGAGGCGTCTGTTGTCAATCCCTTTGCTCGAATCTCGGATGTTCTCTGTGCCAGGTCCCC

CTCAACTGGCATCCTTCTCAAGTGGTTTTAGCTGGAGATAGTAATTGCTTAGAAAGGCGTGAAACTTTCTTTACTTCAAGGCAAGGATTTCCAGTTTAAA

AATAAATTCATTTACTC
Translation
 MQEDSIEASTSISQLLRESYLAETRHRGDNERSRAEPSSNPFHFSGPGAAEGGGPEDLPDLSAFLSQEELDESVNLARLAINHDPLERVDEAQARKRLS

SDQTKHASKPSFEPAFHQDSSRGPASPKDSPPETKRPQYSSETQSKKVFLNKAADFIEELSSLFKAHSSKRIRPRACKNHKSKTESQNKVLQENSPTFSD

LTERRERASVPIPIPADSRDNELNHAIEQREAKRREAELAAGEAAAGDSTPGSSPSSLYYEEPLGQPPRFTQKLRSREVPEGSRVQLDCIVVGIPPPQVR

 - UNI13763 - RWYCEGKELENSPDIHIVQAGNLHSLTIAEAFEEDTGRYSCFASNIYGTDSTSAEIYIEG - UNI22021 - GVSSSDSEGDPN

KEEMNR - UNI22468 - RIQKPNEVSSPPTTSAAIPPAAEAQPLAAQPRVSTVQQ CQSPTNYLQGLNGKPIIAAPVFTK - UNI24302 - MLQ

NLSASEGQLVVFECRVKGAPSPKVEWYREGTLIEDSPDFRILQKK KPRSMAEPE EEICTLVIAEVFSEDSGCFTCTASNKYGTVSSIAQLDVRG GNE

DISDNGALHSANSTTNPAVAEHQPSPLNPQPLSEEQPPKPKLEGVLVNHNEPRSSSRIGLRVHFNLPEDDKDMEASSGSGAANTSQTRPNSFPERFNGQE

ARIPEPSSPIKEPPPVLAKPKL LDSTQLQQLHNQVLLEQQQLQNTSPSSPKESLHMSALNSAPPAVTISSKQVKGPAPQMFNLARPKHFFPASSTSTAT

VSPSSSPVFTLSNTPQTIQRTVSKESLLMAHPSTQGRSPGGLSIQNEPAPPSPAEPAAPPTAAYSIPSGNQFQPHCVSPTPVSPTGRIQNPVAFLSSVLP

SLPSIPPTNAMGLPKSAPSV VPSQGLMKKTTKAPQAVSDDYIRETKNSVILDLGKKVNFGDVRSHQQ EYKISSFEQRLMNEIEFRLERTPVDESDDEI

EHDEIPTGKCIAPIFDKRLKHFRVTEGSPVTFTCKIVGIPVPK VYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTHGDDDGNYTIMAANPQ GRISC

SGHLMVQGLPIRSRLSPALSHR RGRSRMQERDKEPLQERFFRPHFLQAPGDMVAHEGRLCRLDCK VSGLPPPELTWLLNGQPVLPDASHKMLVRETGV

HSLLIDPLTQRDAGTYTCVATNKTGQNSFSLELTVVA AKEVKKAPVILEKLQNSGVPEGHPVRLEGRVIGMPPPVFYWKKDNETIPFTRERIS SMHQD

TTGYVCLLIQPAKKSDAGWYTLSAKNEAGIVSCTARLDIYA AQWHQQIPTPISIRPSGSRYGSLTSKGLDIFSAFSSVESTMLYSCTSRSVVESDEL

For any suggestions or comments, please send an email to unitrap@crg.es