Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020076 (Ddx50)
Chromosomal location
Chr 10: 62078771 - 62113966 (-)
Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 Gene [Source:MGI Symbol;Acc:MGI:2182303]
RefSeq_dna
NM_053183 
RefSeq_peptide
NP_444413.1 
MGI
MGI:2182303 
Uniprot/SWISSPROT
Q99MJ9 
Uniprot/SPTREMBL
Q5BKP5 Q8BRU5 
Human Ortholog
ENSG00000107625 (DDX50)
Omim not available
UniTrap UNI23718
Vector Insertion
Chr 10: 62106121 - 62109661
Public Clones not available
Private Clones OST247912 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8481
Vector Insertion
Chr 10: 62096875 - 62102608
Public Clones RRK454 (baygenomics)
Private Clones OST288723 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1672
Vector Insertion
Chr 10: 62084272 - 62087515
Public Clones CH0373 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3772
Vector Insertion
Chr 10: 62079265 - 62082332
Public Clones XQ0382 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020270
Sequence
ACGGTCCTGGCCGGCGGGGCCGCCCAGCCCCCGCTTCCTTTCACGCTCTCGGTGGCCGTAGGTGGTCGCGGCCACCGCAGCCGGGCGGGAGGTTGCGACG

GCCAGTAATGCCCGGGAAACTCCTCTGGGGAGACATAATGGAGCTCGAGGCACCCTTGGAAGAGTCCGAGAGCCAGAGGAAGGAGCGGCAAAAG AGTGA

TAGAAGGAAGTCAAGGCACCATTCTGAATCAGAGGAGAGAACAGAAACAAGAGAAAATGGTGTTACAGATGACCTGGATGCTCCCAAGCCCAAAAAAGCT

AAAATGAGAGAAAAGCTAAATGGAGACACCAAAGAAGGACTTAGATTTTCAGATGAATTCTCCCCATCTCATAAGTCAAGAAGAAAAGACCTGCCAAATG

GAGATGTGGATGAGTATGAGAAAAGGTCAAAGCGAGTGTCATCCTCAGAAAACTCTCACAAGTCAAGCGATAAAGCAGAGGAG - UNI23718 - ACT

CTAACACGTGAACAAAAGGAAGGAGCCTTCTCTAATTTCTCCATTTCTGAGGAGACCATAAAGCTTCTGAAAG GTCGAGGGGTAACATATCTCTTTCCT

ATTCAAGTTAAAACCTTTGGTCCTGTATATGAAGGAAAAGATTTAATTGCTCAAGCCCGGACAGGAACAGGAAAGACATTCTCTTTTGCCATACCCTTGA

TTGAAAGGCTCCAAAGAAATCAAGAAACAATTAAAAAAAGCCGCTCACCAAAG GTACTCGTTTTGGCTCCAACAAGGGAATTGGCAAATCAAGTAGCCA

AAGATTTCAAAGATATAACTAGAAAACTCAGTGTGGCGTGTTTTTATGGTGGAACATCATATCAAAGCCAGA TTAATCAAATTCGGAATGGTATTGACA

TCCTTGTTGGGACCCCAGGGCGTATCAAAGACCATCTGCAAAGTGGCCGTTTGGATCTTTCAAAGCTACGCCATGTTGTGCTTGATGAAGTAGATCAAAT

GTTAGATTTAGGTTTTGCTGAACAAGTCGAAGATATTATTCATGAATCTTACAAAACTG ATTCGGAAGACAATCCTCAGACCTTACTTTTTTCTGCAAC

TTGCCCACAGTGGGTATACAAAGTTGCAAAAAAATACATGAAATCCAGATACGAACAGGTTGACCTTGTTGGAAAAATGACTCAAAAAGCTGCAACCACT

GTGGAA - UNI8481 - CATTTGGCTATCCAGTGCCATTGGTCTCAGAGACCAGCAGTTATTGGAGATGTCCTTCAGGTCTACAGTGGGTCTGAAGGG

AGAGCTATTATCTTCTGTGAAACTAAGAAGAATGTTACTGAAATGGCCATGAATCCACACATAAAGCAG AATGCTCAGTGTTTGCATGGAGACATTGCA

CAGTCACAAAGAGAAATTACCTTGAAAGGCTTCAGAGAAGGTAGTTTTAAAGTTTTGGTAGCAACCAATGTGGCTGCTCGTGGCTTGGACATTCCTGAGG

TTGACCTAGTGATTCAGAGTTCTCCTCCACAG GATGTTGAATCCTATATCCATCGCTCTGGACGCACAGGTAGAGCTGGCCGGACAGGAATTTGTGTAT

GTTTTTATCAACCAAGGGAAAGAGGTCAACTGAGATATGTGGAGCAGAAAGCT GGAATTACTTTTAAACGTGTAGGTGTTCCGTCTACAATGGATTTAG

TTAAATCTAAAAGCATGGATGCCATCAG GTCTCTGGCTTCTGTTTCTTATGCTGCTGTTGATTTTTTCCGACCATCAGCTCAAAGACTGATAGAAGAGA

AGGGGGCAGTGGATGCATTGGCTGCAGCATTAGCTCACATTTCTGGTGCATCAAGCTTTGAACCACGATCTTTGATAACTTCTGATAAG - UNI1672 

- GGGTTTGTGACCATGACTCTGGAGAGCCCAGAAGAAATACAGGATGTCAGCTGCGCTTGGAAGGAACTTAACAGAAAGCTCAGTAGTAATGCTGTGTC

TCACGTAACCAGAATGTGCCTCCTGAAAGGAAATATG GGTGTTTGCTTTGATGTTCCTACAAGTGAGTCAGAAAGATTACAG - UNI3772 - GCAG

AGTGGCATGATTCAGACTGGATACTCTCAGTGCCAGCCAAATTACCTGAAATTGAAGAATATTATGATGGAAACACATCATCTAATCCCAGACAGAGGAG

CGGCTGGTCTGGCGGCAGGTCAGGCCGTTCAGGACGGTCTGGTGGTCGATCTGGTGGCCGATCAGGTAGACAGAGTCGACAGGGAAGTCGGTCAGGAAGT

CGGCAAGATGGTAGAAGACGAAGTGGGAACAGAAATCGATCAAGAAGTGGGGGCCATAAACGGAATTTTGACTGAGTGTTTGATAGTTAATCTTCCAGTG

TGAGCTTGCCTATTTCTGTCTAATCATGTATATTATTCACCAAAAATTAGATCATCATAGTTGAGGTATTTGTCTGTAATTTGCAAAGAAGTTGGTCGTA

TTTTTTTAAAAAGTATTTCACAAGAATGGTTCTAAACAAATCTACTTATCTGGCTATACCTTTGAATTAAAAAAAAGCCCTTTTATTGTC
Translation
MPGKLLWGDIMELEAPLEESESQRKERQK SDRRKSRHHSESEERTETRENGVTDDLDAPKPKKAKMREKLNGDTKEGLRFSDEFSPSHKSRRKDLPNGD

VDEYEKRSKRVSSSENSHKSSDKAEE - UNI23718 - TLTREQKEGAFSNFSISEETIKLLKG GRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTG

KTFSFAIPLIERLQRNQETIKKSRSPK VLVLAPTRELANQVAKDFKDITRKLSVACFYGGTSYQSQI INQIRNGIDILVGTPGRIKDHLQSGRLDLSK

LRHVVLDEVDQMLDLGFAEQVEDIIHESYKTD DSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVE - UNI8481 - HLAIQ

CHWSQRPAVIGDVLQVYSGSEGRAIIFCETKKNVTEMAMNPHIKQ NAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQ

 DVESYIHRSGRTGRAGRTGICVCFYQPRERGQLRYVEQKA GITFKRVGVPSTMDLVKSKSMDAIR RSLASVSYAAVDFFRPSAQRLIEEKGAVDALA

AALAHISGASSFEPRSLITSDK - UNI1672 - GFVTMTLESPEEIQDVSCAWKELNRKLSSNAVSHVTRMCLLKGNM GVCFDVPTSESERLQ - U

NI3772 - AEWHDSDWILSVPAKLPEIEEYYDGNTSSNPRQRSGWSGGRSGRSGRSGGRSGGRSGRQSRQGSRSGSRQDGRRRSGNRNRSRSGGHKRNF

D

For any suggestions or comments, please send an email to unitrap@crg.es