Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020077 (Srgn)
Chromosomal location
Chr 10: 61956581 - 61990199 (-)
Description
serglycin Gene [Source:MGI (curated);Acc:Srgn]
RefSeq_dna
NM_011157 
RefSeq_peptide
NP_035287.1 
UniGene
Mm.467094 
MGI
MGI:97756 
Uniprot/SWISSPROT
P13609 
Human Ortholog
ENSG00000122862 (SRGN)
Omim not available
UniTrap UNI31057
Vector Insertion
Chr 10: 61970660 - 61990200
Public Clones IST10313G5 (tigm) IST10313F8 (tigm) IST12521A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22246
Vector Insertion
Chr 10: 61970389 - 61970490
Public Clones not available
Private Clones OST302501 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28420
Vector Insertion
Chr 10: 61957176 - 61957855
Public Clones not available
Private Clones OST31456 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105445
Sequence
GGGAGTCCGGTGGAGTTTCATCATGG - UNI22246 - - UNI31057 - AGGCTGAGTGGAGCCGAGCTGGTCAGGATGCAGGTTCCCGTCGGCAG

CAGGCTTGTCCTGGCTCTCGCCTTCGTCCTGGTTTGGGGATCTTCAGTGCAAG - UNI22246 - GTTATCCTGCTCGGAGAGCCAGGTACCAGTGGG

TCCGCTGCAAACCGAATGGCTTTTTTGCGAACTGCATCGAGGAGAAGGGACCACAGTTTGACCTAATAGATGAATCCAATAACATCGGCCCTCCCATGAA

TAATCCTGTTTT - UNI28420 - GATGGAAGGACCCTCAAAAGATTTCATCTCCAATTATGATGACTATGGGTCAGGTTCGGGCTCCGGCTCTGGCT

CCGGCTCTGGCTCGGGTTCCGGCTCCGGAAGTGGCTTCCTAGGTGACATGGAATGGGAATACCAGCCAACAGATGAAAGCAATATTGTCTATTTCAACTA

TAAGCCTTTTGACAGGATTCTCACTGAGCAAAACCAAGACCAACCAGAAGACGATTTTATTATATGAATGTGACGGTCTCTGTCTCCCCACCTCCATGTG

GAACAATGTATTCAGTATACTTAGTGTACCACGTTTAAATGACCAGTCTCAGGATAAAGAGTTTTACAGAAAATTTAAAATGCCTGGAAAAGACTCTTGA

ATCCTGTTACCCCTTTCCTCATTAACTCGTAAGGAATTATGCTTTAATG
Translation
 - UNI22246 - - UNI31057 - MQVPVGSRLVLALAFVLVWGSSVQG - UNI22246 - GYPARRARYQWVRCKPNGFFANCIEEKGPQFDLI

DESNNIGPPMNNPVL - UNI28420 - LMEGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQ

DQPEDDFII
Transcript ENSMUST00000105446
Sequence
TACTCCAGCTGAGCCAAGAGCCGGACAGCTTAAGATCTCACCGGAAGGAGAACGCCACAGAAAGCCAGCAGACCCCGCTCCTCGGCCGGCCGTGTGGCCC

AGGCAGGTCAGAG - UNI31057 - GAAACTGTGACGTGTGTTCTTGGGCAGGGTCTGAGGTTTTGGAACCTCTTTCTAAAAGGGACAGAAAGAGCAC

CCTGCTACATTTGCTAATCCAGAGGCTGAGTGGAGCCGAGCTGGTCAGGATGCAGGTTCCCGTCGGCAGCAGGCTTGTCCTGGCTCTCGCCTTCGTCCTG

GTTTGGGGATCTTCAGTGCAAG - UNI22246 - GTTATCCTGCTCGGAGAGCCAGGTACCAGTGGGTCCGCTGCAAACCGAATGGCTTTTTTGCGAA

CTGCATCGAGGAGAAGGGACCACAGTTTGACCTAATAGATGAATCCAATAACATCGGCCCTCCCATGAATAATCCTGTTTT - UNI28420 - GATGG

AAGGACCCTCAAAAGATTTCATCTCCAATTATGATGACTATGGGTCAGGTTCGGGCTCCGGCTCTGGCTCCGGCTCTGGCTCGGGTTCCGGCTCCGGAAG

TGGCTTCCTAGGTGACATGGAATGGGAATACCAGCCAACAGATGAAAGCAATATTGTCTATTTCAACTATAAGCCTTTTGACAGGATTCTCACTGAGCAA

AACCAAGACCAACCAGAAGACGATTTTATTATATGAATGTGACGGTCTCTGTCTCCCCACCTCCATGTGGAACAATGTATTCAGTATACTTAGTGTACCA

CGTTTAAATGACCAGTCTCAGGATAAAGAGTTTTACAGAAAATTTAAAATGCCTGGAAAAGACTCTTGAATCCTGTTACCCCTTTCCTCATTAACTCGTA

AGGAATTATGCTTTAATGCTGTTACCTATCTTGTTGTTCTGGAAAATGCCTGCATTTATGTGTATTGAATCAACATTTAAGAAATTAACACACACCCCCA

TTATTATACAATAACTTTCAAAGCCATACTGGTTTTGAAAATTTTAATTTGATAGCAAGTTGATGAACAATCTTTCATACCTAAAGTGTTCAGGAACCCA

ACTCGCATTGTGAATTACAAATATATTCCTTTATGTGATTAAAAAGAAAATAAAGTGAAACACAGTGGCCTCCTACCGTGGCTATGTGACATGGTTTACA

TGGTGAGGGGTAGATATTGAGCTGTGGCCATTGGATGTGACAGGGAAGACCAAATGTTATCGAAAAATGTTGTGGGTTTTTTGTTTGTTTGTTTGTTTGT

TTTTTGTTGTTGTTTTTGAGACAGGGTTTCCAGGACAGGTTGTCCTGTAACTCACTCTGTAGACCAGGATGGCTAGATTCAGAAATCCTCATGCTTCTGC

CTCCCAAGTGCTGGGATTAAAGGCATGCGCCACCCCCCACCCCACCCCCGGGGTTGTTGTGGGTTTTAAAGTTAGAAACTTAACGCCTCAAATAACATGG

AGTTGTGGTCTCAACGGCTCATAATGCTTTACCTTTGTCTAGATGCCTGTTCAGGGTCAAATGTTACTCCATTAAAGTGAACATATAACCAAAGGGGGGA

GATGTCATCTGGAACTTCCTGTTCTAATCCAGGGAATAGTTACTTTGAAAAAATAATCAATCATATTATACATATTAATATATAATAATTTTATAATACA

GTATATAATATTGGTGTAGGTGATATTTAATATAAATAATATAATAAAAAGTGTATGTAATTGATAACA
Translation
 - UNI31057 - MQVPVGSRLVLALAFVLVWGSSVQG - UNI22246 - GYPARRARYQWVRCKPNGFFANCIEEKGPQFDLIDESNNIGPPMNNP

VL - UNI28420 - LMEGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII
Transcript ENSMUST00000020271
Sequence
CATTTGCTAATCCAGAGGCTGAGTGGAGCCGAGCTGGTCAGGATGCAGGTTCCCGTCGGCAGCAGGCTTGTCCTGGCTCTCGCCTTCGTCCTGGTTTGGG

GATCTTCAGTGCAAG - UNI22246 - GTTATCCTGCTCGGAGAGCCAGGTACCAGTGGGTCCGCTGCAAACCGAATGGCTTTTTTGCGAACTGCATC

GAGGAGAAGGGACCACAGTTTGACCTAATAGATGAATCCAATAACATCGGCCCTCCCATGAATAATCCTGTTTT - UNI28420 - GATGGAAGGACC

CTCAAAAGATTTCATCTCCAATTATGATGACTATGGGTCAGGTTCGGGCTCCGGCTCTGGCTCCGGCTCTGGCTCGGGTTCCGGCTCCGGAAGTGGCTTC

CTAGGTGACATGGAATGGGAATACCAGCCAACAGATGAAAGCAATATTGTCTATTTCAACTATAAGCCTTTTGACAGGATTCTCACTGAGCAAAACCAAG

ACCAACCAGAAGACGATTTTATTATATGAATGTGACGGTCTCTGTCTCCCCACCTCCATGTGGAACAATGTATTCAGTATACTTAGTGTACCACGTTTAA

ATGACCAGTCTCAGGATAAAGAGTTTTACAGAAAATTTAAAATGCCTGGAAAAGACTCTTGAATCCTGTTACCCCTTTCCTCATTAACTCGTAAGGAATT

ATGCTTTAATGCTGTTACCTATCTTGTTGTTCTGGAAAATGCCTGCATTTATGTGTATTGAATCAACATTTAAGAAATTAACACACACCCCCATTATTAT

ACAATAACTTTCAAAGCCATACTGGTTTTGAAAATTTTAATTTGATAGCAAGTTGATGAACAATCTTTCATACCTAAAGTGTTCAGGAACCCAACTCGCA

TTGTGAATTACAAATATATTCCTTTATGTGATTAAAAAGAAAATAAAGTGAAACACAGTGGCCTCC
Translation
MQVPVGSRLVLALAFVLVWGSSVQG - UNI22246 - GYPARRARYQWVRCKPNGFFANCIEEKGPQFDLIDESNNIGPPMNNPVL - UNI28420 

- LMEGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII

For any suggestions or comments, please send an email to unitrap@crg.es