Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020078 (Vps26a)
Chromosomal location
Chr 10: 61918025 - 61949506 (-)
Description
vacuolar protein sorting 26 homolog A (yeast) Gene [Source:MGI Symbol;Acc:MGI:1353654]
RefSeq_dna
NM_133672 
RefSeq_peptide
NP_001106826.1 NP_598433.1 
UniGene
Mm.473468 Mm.260703 
MGI
MGI:1353654 
Uniprot/SWISSPROT
P40336 
Uniprot/SPTREMBL
Q6PE78 
Human Ortholog
ENSG00000122958 (VPS26A)
Omim not available
UniTrap UNI7908
Vector Insertion
Chr 10: 61949225 - 61949405
Public Clones RRM083 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22342
Vector Insertion
Chr 10: 61943456 - 61949125
Public Clones E045G10 (ggtc)
Private Clones OST299699 (lexicon) OST262865 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22096
Vector Insertion
Chr 10: 61943305 - 61943456
Public Clones not available
Private Clones OST308724 (lexicon) OST151762 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1764
Vector Insertion
Chr 10: 61933884 - 61943305
Public Clones CF0395 (sanger) (sanger) RRS111 (baygenomics) RRF190 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19303
Vector Insertion
Chr 10: 61932806 - 61933807
Public Clones not available
Private Clones OST395682 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020272
Sequence
GCCTACGGTCACGTGACGGGCGGCGGGGCGCAGGCACCCAGGCTGGGAGTTCTTCTGAGGGAAAGCCGAGTGGAGTGGGCGACCCGGCGGCGGTGACAAT

G - UNI7908 - - UNI22096 - - UNI22342 - AGTTTTCTTGGAGGCTTTTTTGGTCCCATTTGTGAGATTGATGTTGCCCTTAATGATGGG

GAAACCAGGAAAATGGCAGAAATGAAAACTGAGGATGGCAAAGTAGAAAAACACTATCTCTTCTATGATGGCGAGTCTGTCTCAGGAAAG - UNI1764

 - - UNI22096 - GTAAACCTAGCCTTTAAGCAGCCTGGAAAGAGGCTAGAGCATCAAGGAATTAGAATTGAATTTGTAGGTCAAATTG - UNI19

303 - AGCTTTTCAATGACAAGAGTAATACTCATGAATTTGTAAACCTAGTGAAGGAACTAGCCTTGCCTGGAGAACTGACTCAGAGCAGAAGCTATGA

CTTTGAATTTATGCAAGTTGAAAAGCCATATGAGTCATACATCGGTGCCAATGTCCGCCTGAG GTATCATTTAAAGGATGTAATTGTTGGAAAAATTTA

CTTCTTATTAGTAAGAATAAAAATACAACACATGGAATTACAGCTGATCAAGAAAGAGATCACAGGAATTG GACCCAGCACCACAACAGAGACAGAAAC

AATCGCTAAGTATGAAATAATGGATGGGGCGCCAGTAAAAG GAGAATCTATTCCGATAAGATTGTTCTTAGCAGGGTATGACCCAACCCCCACGATGAG

AGATGTGAACAAGAAGTTTTCAGTAAGGTACTTTCTAAACCTCGTGCTTGTTGATGAGGAGGACCGAAGGTACTTCAAGCAGCAG GAGATCATCCTGTG

GAGAAAAGCACCCGAGAAACTGAGAAAACAGAGGACGAACTTTCACCAGCGGTTTGAATCTCCAGACTCGCAGGCCTCTGCGGAGCAGCCTGAGATGTAA

GCAGGTGGGCAGAGCAGCAAGTGCAAGAACCGGGCCAAGAGAGCAGCTCAGCTGGCTGACGACAGTCGCAGCGTGCGGACATCCCAACTCCACGTCTGCT

AGTCTTCCTTATCCTAGAGTGCTGCGTTTATTTTACAGTATGATTAAAGGTTTTGTGTATATACATTTTAAAAAGTGCTTCTTGGAAACACTGGAGAATT

CCTAAGCTGCCTTTTTTGTTTTCTTTTTTACTGCACACTGATAAGCACTCAGAAGCATAAACATTAAGGATTTTCATGTGAGTAGACTGGTATTTGTAAT

TTTGCTTTCTTTATGCATAATGTTGAAAATCCTTTTCTCTGTTTTCATGCTAATGATTACCTCTTATTCTCTATGTGCAAAAAATTAAATATTTTTGTTC

AAGTAAAATGAGAAAAACCTGAGCAGCCCTTATGTCCTACAAAGTTTTAAGGCATGGCTCCTCAGTATTTTTGAGAATTGTGTTTATTTTTACATGTGGA

TCAGAAACCAACCTGGTGTTACATGGTAGGCACTTCTGGGTCTACCATTCACAGCCTCCTGAATTTTAATCTTTGGGATCTCTGAGGTATATGAAAGATT

GTCACCCCAGGGATGACATGGTTTGTCATCGTGGCCCTCTTGCCCCTTATTGACCACGTTTGCTATGACTTTCTGTATCATCATGTAGGTTCTGCAGTGT

GGAGTTGACACATTGGCATTTTAGAACTTGTTAAACCTGTATCATTTTTTTTCCATAAAGACTTTGAAACATGTATATATTTTTTAATTTAAGGACTACT

TTCCATGTGTATGCAAATCGTCACCTAGGAATGAGAGAGCTTGGGAGAACCAGCCGAAGTGTCCATAGCCGGACAATTTCTTGTTAACTGGAATATTGGC

TAGTTCAAACTTGACTTCACGTAGTCTATTTAAAAAAACCCGAACCAAACAGAACAAAAAACACTAAATTCATACCATTCTCTGAAAAGAAGGCTGCAGT

CAGCTGAGCACAGACACACAACTGAGGCGTATGGGGCAGGAGGAAGCCTGTGTGGGGGCCACTCTCACTCAGGGCTTGTTGGTTTCTGTACCAGTGTTCC

TTGATACACCTCAGTACAGGTTTGTCAGTTAACTTTACTTTCTAGGAAGCTCAACAGCCCAACTTATGTTTCCTTAAACCTATTTTTTACTATGATGGCA

CTTTGATAAAATGGCCAGCAACCAGCCCTGGCCAAAGGTTCACATACCACGTCCTGGAGCAGCTATTGTCAATGTGGGTTTCTAAGGACGGCCATGTTCT

CCTTCATGTAAGTGCCTGTTCAGAGTCTCAAAGTTTCAAAATGCCAAATATTTTCATGGTCACTTGCATGTATAATCTAGGAAATATTCAAGGAGATTTT

GAAAAACAATTGTATTTAACCAGCCTCAAGTTGTGCAACCATGATATATAAAATAAATAATTTGAAAC
Translation
 - UNI7908 - - UNI22096 - - UNI22342 -  - UNI1764 - - UNI22096 -  - UNI19303 - MQVEKPYESYIGANVRLR RY

HLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIG GPSTTTETETIAKYEIMDGAPVKG GESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDE

EDRRYFKQQ EIILWRKAPEKLRKQRTNFHQRFESPDSQASAEQPEM
Transcript ENSMUST00000092473
Sequence
ATGTCGGAGCCTCTGCCCGCCTTCCTCGACCGGCTGTGGGGACCCTGGCTGGGCACCCGCAGCCCGCCCAGCCGGAGCTCGGCAGCCTCGCCTTCCAAG 

- UNI22096 - - UNI22342 - AGTTTTCTTGGAGGCTTTTTTGGTCCCATTTGTGAGATTGATGTTGCCCTTAATGATGGGGAAACCAGGAAAAT

GGCAGAAATGAAAACTGAGGATGGCAAAGTAGAAAAACACTATCTCTTCTATGATGGCGAGTCTGTCTCAGGAAAG - UNI1764 - - UNI22096 

- GTAAACCTAGCCTTTAAGCAGCCTGGAAAGAGGCTAGAGCATCAAGGAATTAGAATTGAATTTGTAGGTCAAATTG - UNI19303 - AGCTTTTC

AATGACAAGAGTAATACTCATGAATTTGTAAACCTAGTGAAGGAACTAGCCTTGCCTGGAGAACTGACTCAGAGCAGAAGCTATGACTTTGAATTTATGC

AAGTTGAAAAGCCATATGAGTCATACATCGGTGCCAATGTCCGCCTGAG GTATTTTCTTAAGGTGACAATTGTGAGAAGATTGACAGACTTAGTGAAAG

AGTACGATCTTATTGTTCATCAGCTAGCCACCTATCCTGATGTCAACAACTCTATTAAAATGGAAGTGGGCATTGAAGACTGTCTGCACATAGAGTTTGA

ATATAATAAGTCCAA GTATCATTTAAAGGATGTAATTGTTGGAAAAATTTACTTCTTATTAGTAAGAATAAAAATACAACACATGGAATTACAGCTGAT

CAAGAAAGAGATCACAGGAATTG GACCCAGCACCACAACAGAGACAGAAACAATCGCTAAGTATGAAATAATGGATGGGGCGCCAGTAAAAG GAGAAT

CTATTCCGATAAGATTGTTCTTAGCAGGGTATGACCCAACCCCCACGATGAGAGATGTGAACAAGAAGTTTTCAGTAAGGTACTTTCTAAACCTCGTGCT

TGTTGATGAGGAGGACCGAAGGTACTTCAAGCAGCAG GAGATCATCCTGTGGAGAAAAGCACCCGAGAAACTGAGAAAACAGAGGACGAACTTTCACCA

GCGGTTTGAATCTCCAGACTCGCAGGCCTCTGCGGAGCAGCCTGAGATGTAAGCAGGTGGGCAGAGCAGCAAGTGCAAGAACCGGGCCAAGAGAGCAGCT

CAGCTGGCTGACGACAGTCGCAGCGTGCGGACATCCCAACTCCACGTCTGCTAGTCTTCCTTATCCTAGAGTGCTGCGTTTATTTTACAGTATGATTAAA

GGTTTTGTGTATATACATTTTAAAAAGTGCTTCTTGGAAACACTGGAGAATTCCTAAGCTGCCTTTTTTGTTTTCTTTTTTACTGCACACTGATAAGCAC

TCAGAAGCATAAACATTAAGGATTTTCATGTGAGTAGACTGGTATTTGTAATTTTGCTTTCTTTATGCATAATGTTGAAAATCCTTTTCTCTGTTTTCAT

GCTAATGATTACCTCTTATTCTCTATGTGCAAAAAATTAAATATTTTTGTTCAAGTAAAATGAGAAAAACCTGAGCAGCCCTTATGTCCTACAAAGTTTT

AAGGCATGGCTCCTCAGTATTTTTGAGAATTGTGTTTATTTTTACATGTGGATCAGAAACCAACCTGGTGTTACATGGTAGGCACTTCTGGGTCTACCAT

TCACAGCCTCCTGAATTTTAATCTTTGGGATCTCTGAGGTATATGAAAGATTGTCACCCCAGGGATGACATGGTTTGTCATCGTGGCCCTCTTGCCCCTT

ATTGACCACGTTTGCTATGACTTTCTGTATCATCATGTAGGTTCTGCAGTGTGGAGTTGACACATTGGCATTTTAGAACTTGTTAAACCTGTATCATTTT

TTTTCCATAAAGACTTTGAAACATGTATATATTTTTTAATTTAAGGACTACTTTCCATGTGTATGCAAATCGTCACCTAGGAATGAGAGAGCTTGGGAGA

ACCAGCCGAAGTGTCCATAGCCGGACAATTTCTTGTTAACTGGAATATTGGCTAGTTCAAACTTGACTTCACGTAGTCTATTTAAAAAAACCCGAACCAA

ACAGAACAAAAAACACTAAATTCATACCATTCTCTGAAAAGAAGGCTGCAGTCAGCTGAGCACAGACACACAACTGAGGCGTATGGGGCAGGAGGAAGCC

TGTGTGGGGGCCACTCTCACTCAGGGCTTGTTGGTTTCTGTACCAGTGTTCCTTGATACACCTCAGTACAGGTTTGTCAGTTAACTTTACTTTCTAGGAA

GCTCAACAGCCCAACTTATGTTTCCTTAAACCTATTTTTTACTATGATGGCACTTTGATAAAATGGCCAGCAACCAGCCCTGGCCAAAGGTTCACATACC

ACGTCCTGGAGCAGCTATTGTCAATGTGGGTTTCTAAGGACGGCCATGTTCTCCTTCATGTAAGTGCCTGTTCAGAGTCTCAAAGTTTCAAAATGCCAAA

TATTTTCATGGTCACTTGCATGTATAATCTAGGAAATATTCAAGGAGATTTTGAAAAACAATTGTATTTAACCAGCCTCAAGTTGTGCAACCATGATATA

TAAAATAAATAATTTGAAAC
Translation
MSEPLPAFLDRLWGPWLGTRSPPSRSSAASPSK - UNI22096 - - UNI22342 - SFLGGFFGPICEIDVALNDGETRKMAEMKTEDGKVEKHYL

FYDGESVSGK - UNI1764 - - UNI22096 - VNLAFKQPGKRLEHQGIRIEFVGQIE - UNI19303 - ELFNDKSNTHEFVNLVKELALPGE

LTQSRSYDFEFMQVEKPYESYIGANVRLR RYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSK KYHLKDVIVGKIY

FLLVRIKIQHMELQLIKKEITGIG GPSTTTETETIAKYEIMDGAPVKG GESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQ E

IILWRKAPEKLRKQRTNFHQRFESPDSQASAEQPEM
Transcript ENSMUST00000105447
Sequence
GCCTACGGTCACGTGACGGGCGGCGGGGCGCAGGCACCCAGGCTGGGAGTTCTTCTGAGGGAAAGCCGAGTGGAGTGGGCGACCCGGCGGCGGTGACAAT

G - UNI7908 - - UNI22096 - - UNI22342 - AGTTTTCTTGGAGGCTTTTTTGGTCCCATTTGTGAGATTGATGTTGCCCTTAATGATGGG

GAAACCAGGAAAATGGCAGAAATGAAAACTGAGGATGGCAAAGTAGAAAAACACTATCTCTTCTATGATGGCGAGTCTGTCTCAGGAAAG - UNI1764

 - - UNI22096 - GTAAACCTAGCCTTTAAGCAGCCTGGAAAGAGGCTAGAGCATCAAGGAATTAGAATTGAATTTGTAGGTCAAATTG - UNI19

303 - AGCTTTTCAATGACAAGAGTAATACTCATGAATTTGTAAACCTAGTGAAGGAACTAGCCTTGCCTGGAGAACTGACTCAGAGCAGAAGCTATGA

CTTTGAATTTATGCAAGTTGAAAAGCCATATGAGTCATACATCGGTGCCAATGTCCGCCTGAG GTATTTTCTTAAGGTGACAATTGTGAGAAGATTGAC

AGACTTAGTGAAAGAGTACGATCTTATTGTTCATCAGCTAGCCACCTATCCTGATGTCAACAACTCTATTAAAATGGAAGTGGGCATTGAAGACTGTCTG

CACATAGAGTTTGAATATAATAAGTCCAA GTATCATTTAAAGGATGTAATTGTTGGAAAAATTTACTTCTTATTAGTAAGAATAAAAATACAACACATG

GAATTACAGCTGATCAAGAAAGAGATCACAGGAATTG GACCCAGCACCACAACAGAGACAGAAACAATCGCTAAGTATGAAATAATGGATGGGGCGCCA

GTAAAAG GAGAATCTATTCCGATAAGATTGTTCTTAGCAGGGTATGACCCAACCCCCACGATGAGAGATGTGAACAAGAAGTTTTCAGTAAGGTACTTT

CTAAACCTCGTGCTTGTTGATGAGGAGGACCGAAGGTACTTCAAGCAGCAG GAGATCATCCTGTGGAGAAAAGCACCCGAGAAACTGAGAAAACAGAGG

ACGAACTTTCACCAGCGGTTTGAATCTCCAGACTCGCAGGCCTCTGCGGAGCAGCCTGAGATGTAAGCAGGTGGGCAGAGCAGCAAGTGCAAGAACCGGG

CCAAGAGAGCAGCTCAGCTGGCTGACGACAGTCGCAGCGTGCGGACATCCCAACTCCACGTCTGCTAGTCTTCCTTATCCTAGAGTGCTGCGTTTATTTT

ACAGTATGATTAAAGGTTTTGTGTATATACATTTTAAAAAGTGCTTCTTGGAAACACTGGAGAATTCCTAAGCTGCCTTTTTTGTTTTCTTTTTTACTGC

ACACTGATAAGCACTCAGAAGCATAAACATTAAGGATTTTCATGTGAGTAGACTGGTATTTGTAATTTTGCTTTCTTTATGCATAATGTTGAAAATCCTT

TTCTCTGTTTTCATGCTAATGATTACCTCTTATTCTCTATGTGCAAAAAATTAAATATTTTTGTTCAAGTAAAATGAGAAAAACCTGAGCAGCCCTTATG

TCCTACAAAGTTTTAAGGCATGGCTCCTCAGTATTTTTGAGAATTGTGTTTATTTTTACATGTGGATCAGAAACCAACCTGGTGTTACATGGTAGGCACT

TCTGGGTCTACCATTCACAGCCTCCTGAATTTTAATCTTTGGGATCTCTGAGGTATATGAAAGATTGTCACCCCAGGGATGACATGGTTTGTCATCGTGG

CCCTCTTGCCCCTTATTGACCACGTTTGCTATGACTTTCTGTATCATCATGTAGGTTCTGCAGTGTGGAGTTGACACATTGGCATTTTAGAACTTGTTAA

ACCTGTATCATTTTTTTTCCATAAAGACTTTGAAACATGTATATATTTTTTAATTTAAGGACTACTTTCCATGTGTATGCAAATCGTCACCTAGGAATGA

GAGAGCTTGGGAGAACCAGCCGAAGTGTCCATAGCCGGACAATTTCTTGTTAACTGGAATATTGGCTAGTTCAAACTTGACTTCACGTAGTCTATTTAAA

AAAACCCGAACCAAACAGAACAAAAAACACTAAATTCATACCATTCTCTGAAAAGAAGGCTGCAGTCAGCTGAGCACAGACACACAACTGAGGCGTATGG

GGCAGGAGGAAGCCTGTGTGGGGGCCACTCTCACTCAGGGCTTGTTGGTTTCTGTACCAGTGTTCCTTGATACACCTCAGTACAGGTTTGTCAGTTAACT

TTACTTTCTAGGAAGCTCAACAGCCCAACTTATGTTTCCTTAAACCTATTTTTTACTATGATGGCACTTTGATAAAATGGCCAGCAACCAGCCCTGGCCA

AAGGTTCACATACCACGTCCTGGAGCAGCTATTGTCAATGTGGGTTTCTAAGGACGGCCATGTTCTCCTTCATGTAAGTGCCTGTTCAGAGTCTCAAAGT

TTCAAAATGCCAAATATTTTCATGGTCACTTGCATGTATAATCTAGGAAATATTCAAGGAGATTTTGAAAAACAATTGTATTTAACCAGCCTCAAGTTGT

GCAACCATGATATATAAAATAAATAATTTGAAAC
Translation
M - UNI7908 - - UNI22096 - - UNI22342 - SFLGGFFGPICEIDVALNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGK - UNI1764

 - - UNI22096 - VNLAFKQPGKRLEHQGIRIEFVGQIE - UNI19303 - ELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES

YIGANVRLR RYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSK KYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEI

TGIG GPSTTTETETIAKYEIMDGAPVKG GESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQ EIILWRKAPEKLRKQRTNFHQ

RFESPDSQASAEQPEM

For any suggestions or comments, please send an email to unitrap@crg.es