Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020083 (2010107G23Rik)
Chromosomal location
Chr 10: 61570404 - 61572771 (-)
Description
RIKEN cDNA 2010107G23 gene Gene [Source:MGI Symbol;Acc:MGI:1917144]
RefSeq_dna
NM_027251 
RefSeq_peptide
NP_081527.1 
UniGene
Mm.294126 Mm.443489 Mm.468589 Mm.475781 
MGI
MGI:1917144 
Uniprot/SWISSPROT
Q9D882 
Human Ortholog
ENSG00000171224 (C10orf35)
Omim not available
UniTrap UNI28262
Vector Insertion
Chr 10: 61571872 - 61572631
Public Clones not available
Private Clones OST35791 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064050
Sequence
TTTATTGGCAGGTACAGCGCAGCAGAAATTCCCAGCGTCCAGGGAGAATGGTGAGGATCTTGGCCAATGGGGAGATCGTTCAGGATGATGACCCACGAGT

GAGGACGACCACCCAGCACAGAAGTAGCAGCTCTCAGCAG - UNI28262 - GGCTTTTTCAACAGAGGCCACGGCGCACCTCCAGGGGGCCCTGGAC

CCCGCCAGCAGCAGGCAGGTGCCCGACTGGGTGCTGCCCAATCTCCTTTCAGTGACCTGAACCGGCAGCTGGTGAACATGGGCTTCCCACAATGGCACCT

TGGGAACCACGTGGTGGAACCTGTGACCTCCATCCTCCTGCTCTTCCTGCTTATGATGCTCGGGGTTCGTGGCCTCCTGCTTGTGGGCCTGGTCTACCTG

GTGTCTCACCTGAGTCAGCGGTGACCTCCGGGGGACTCATGAGGGCGGGAGTGTTCAGTAGGATTGACTGGACTGGGCTTTGGTGCGACATCATGCACAG

GGGGAGGGAGCTTGGGTGGGCTCAGAAGGTGTGATGGGCATGAGACCGGCTTTGTAGATTTTTCTCCCGCTGCAGGAGGCAGAGGGACTCTCTGGGCCAG

CATTGCTGAAAAAGAGAGTCCTGTGGTTTCCTGGAATGTTTTTAGGGGGCATAGGGCTTCCGCTAAAAAGCACAAGCAGGAATAAGAAAGGCTTAGTATG

TTGTATTCTCCCAGAACACAAATCTTCTACCAGGCGCAAACCCGGAGCTGAGAGCAGCTGGGAACTGTCCAGAGTTTTATAGCAATCCTTCATTTTAATG

GTGTCCTTTTTTTATTGGCTGATTTTATGTATAAGGAAGGATATTGACATTCTATTTATCATGATCTTTCCTTTTCTTTGGGTTTTCCAAGACAGAGGAG

TCTCACTGTGTAGCCTTGGCTGGCCTGGAACTCACCATGGAGACCAGGTCGGCCTCCAGCTCACAGAGATCCTCCTGTGTCTTCCTCCCAAGTGTTGGGA

CCAAAGGTGTGTGATACTGTGCCCAGCTATTGTGATATTTTCAATAAATAAATTGGAGTCCCTTTTAAGAAGCCGGTGAATGACTGACTCACGGCTGCCC

TGCCTGAAGAAGCTGGTGGGGTGGCTGGGTTTGGAGAAGAGGTGATAGGGCCTTTGACCTTGTGATGTCGGGGATTTTTCTCAGACAGGGTGCTGGGAGG

TGAGGTACAGGCTTGGACCCCTTGCCTAGTGCTGTGGGGAGCTCTAGGCACCCCAATACTCTGAACCCCAAGGTCAGCTTTTGGGGTGGGGGTAGAGTCC

TTAGGATGACTGGGGGCGGAGTGTGTAAGGAGTGAAAGAATGGAGTGTATTGAATGTCTGAGGTCTGTCTTGCTCAGGGGCTCAACCCAGGGGCTGCTCA

GGTTCGTTCGTCCAGCCATCAGCAGCTCTCAGAAGTCCTGGCCATAGTGAGCTCTCCTTAGCAGGTCTCAGGACCAGGGAGCCCTGATTTCCTGACAGGA

GACATGGGTTTGGCTGGTGCTCTCTCTCTCTCTCTCTGCAGTCGTGGTTGTCCTAGAACTCACTCTGTAGACTGGCTGGCCTGGAGGTCCCAGCGCCTGG

ATTAAAGGCATGTGCCACCACC
Translation
MVRILANGEIVQDDDPRVRTTTQHRSSSSQQ - UNI28262 - GFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFSDLNRQLVNMGFPQWHLGNHVVE

PVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR

For any suggestions or comments, please send an email to unitrap@crg.es