Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020089 (Ppa1)
Chromosomal location
Chr 10: 61111369 - 61136913 (+)
Description
pyrophosphatase (inorganic) 1 Gene [Source:MGI Symbol;Acc:MGI:97831]
RefSeq_dna
NM_026438 
RefSeq_peptide
NP_080714.2 
MGI
MGI:97831 
Uniprot/SWISSPROT
Q9D819 
Uniprot/SPTREMBL
Q3UA53 Q4FK49 Q8BTY3 
Human Ortholog
ENSG00000180817 (PPA1)
Omim not available
UniTrap UNI18309
Vector Insertion
Chr 10: 61111540 - 61114307
Public Clones D106A04 (ggtc)
Private Clones OST426040 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10373
Vector Insertion
Chr 10: 61114367 - 61122196
Public Clones XB223 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11453
Vector Insertion
Chr 10: 61133236 - 61135138
Public Clones M118G02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29115
Vector Insertion
Chr 10: 61135182 - 61136566
Public Clones not available
Private Clones OST8379 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020286
Sequence
AGCTCGTGGTACGCAGGCGCGGGCTTTCTCCTCCGTACAGCGGCTCCGGGTCTGGGCTGTGTGGTTGTGTGGCTGTGCAGCGGCGGCGGCGGTGCATCTC

CGACACCATGAGCGGCTTCAGCAGCGAGGAGCGCGCCGCGCCCTTCACCCTCGAGTACCGCGTCTTCCTCA - UNI18309 - AAAATGAGAAAGGGC

AGTACATTTCTCCATTTCATGATGTTCCAATTTATGCAGACAAG - UNI10373 - GATGTGTTCCACATGGTGGTTGAGGTTCCACGCTGGTCCAAC

GCCAAAATGGAG ATTGCTACAAAGGACCCTTTAAACCCAATCAAGCAAGATGTGAAAAAGGGGAAGCTCCGCTATGTGGCGAATCTGTTCCCTTATAAA

GGGTATATTTGGAACTACGGCGCCATCCCTCAG ACATGGGAAGACCCAGGACACAGTGACAAGCACACTGGCTGCTGTGGTGACAACGACCCAATCGAT

GTTTGTGAAATCGGAAGCAAG GTGTGTGCCAGAGGTGAGATAATCAGGGTGAAGGTCCTGGGCATACTGGCCATGATCGATGAGGGCGAGACCGACTGG

AAGGTCATTGCCATTAATGTGGACGATCCGGACGCAGCCAATTATAAAG ATATTTCTGATGTCGAACGGCTAAAACCCGGCTATTTAGAAGCTACTGTT

GATTGGTTTAGAAGGTATAAGGTTCCTGATGGAAAACCAGAAAATGAGTTTGCATTCAATGCAGAATTTAAAAACAAG GACTTTGCAGTTGACATTATT

AAAAGCACCCACGATTATTGGAAAGCATTAGTGACTAAGAAAACAGATGGGAAAGGAATCAGTTG CATGAACACCACGGTGTCGGAGAGCCCCTTCAAG

TGCGATCCTGATGCTGCCAAAGCCATTGTGGATGCT - UNI11453 - TTGCCACCACCATGTGAATCTGCCTGCTCACTGCCGACAGATG - UNI2

9115 - TGGATAAATGGTTCCATCAGCAGAAAAACTGAAGAGCTTCCTCTGGAACACGAGCTGTTACGGCCGCATCCTGTTCACCTGGAAGCATTAGAT

GCAAAAGATTTTCCAAGCTCTAAATTTCTGTAGCTCACCGAATGAAGTAGACTCTGCTGTGACTGGTCCACTAGTTCAGAACTGGTTCAGAAGGTTAGCC

ATCTAGACACCTCACATCTCAACCAAGACAGCTTTTATTAAACCTTAGCTCTCAAAGCCGTGGGGACATGGAAGTCATTTGTGCATGGATGTGCAGTGTG

GACACCTATTGGATGTACATGTTTACTGTGTTAGGAAATAAAATTATTTTACTG
Translation
MSGFSSEERAAPFTLEYRVFLK - UNI18309 - KNEKGQYISPFHDVPIYADK - UNI10373 - DVFHMVVEVPRWSNAKME IATKDPLNPIK

QDVKKGKLRYVANLFPYKGYIWNYGAIPQ TWEDPGHSDKHTGCCGDNDPIDVCEIGSK VCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAAN

YKD DISDVERLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKNK DFAVDIIKSTHDYWKALVTKKTDGKGISC CMNTTVSESPFKCDPDAAKAIV

DA - UNI11453 - LPPPCESACSLPTDV - UNI29115 - VDKWFHQQKN

For any suggestions or comments, please send an email to unitrap@crg.es