Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020101 (4632428N05Rik)
Chromosomal location
Chr 10: 59809599 - 59835432 (+)
Description
RIKEN cDNA 4632428N05 gene Gene [Source:MGI Symbol;Acc:MGI:1921298]
RefSeq_dna
NM_028732 
RefSeq_peptide
NP_083008.1 
UniGene
Mm.470613 Mm.273584 
MGI
MGI:1921298 
Uniprot/SWISSPROT
Q9D659 
Uniprot/SPTREMBL
A3RLQ7 
Human Ortholog
ENSG00000107738 (C10orf54)
Omim not available
UniTrap UNI31798
Vector Insertion
Chr 10: 59812162 - 59820589
Public Clones IST13176F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105459
Sequence
AGAAACATGAAGGAGGGCGGAGCTGGGAGGCTGCAAGGCTGCTGTGGATCTAGGGAAGAGGAACCACAGAAAAGCTAAAGGAGTCACCTCT - UNI317

98 - GTCTGGTAGCAGCCTTCAAGGTCACCACTCCATATTCTCTCTATGTGTGTCCCGAGGGACAGAATGCCACCCTCACCTGCAGGATTCTGGGCCCC

GTGTCCAAAGGGCACGATGTGACCATCTACAAGACGTGGTACCTCAGCTCACGAGGCGAGGTCCAGATGTGCAAAGAACACCGGCCCATACGCAACTTCA

CATTGCAGCACCTTCAGCACCACGGAAGCCACCTGAAAGCCAACGCCAGCCATGACCAGCCCCAGAAGCATGGGCTAGAGCTAGCTTCTGACCACCACGG

TAACTTCTCTATCACCCTGCGCAATGTGACCCCAAGGGACAGCGGCCTCTACTGCTGTCTAGTGATAGAATTAAAAAACCACCACCCAGAACAACGGTTC

TACGGGTCCATGGAGCTACAGGTACAGGCAG GCAAAGGCTCGGGGTCCACATGCATGGCGTCTAATGAGCAGGACAGTGACA GCATCACGGCTGCGGC

CCTGGCCACCGGCGCCTGCATCGTGGGAATCCTCTGCCTCCCCCTTATCCTGCTGCTGGTCTATAAGCAGAGACAGGTGGCCTCTCACCGCC GTGCCCA

GGAGTTGGTGAGGATGGACAG CAACACCCAAGGAATCGAAAACCCAGGCTTCGAGACCACTCCACCCTTCCAGGGGATGCCTGAGGCCAAGACCAGGCC

GCCACTGTCCTATGTGGCCCAGCGGCAACCTTCGGAGTCAGGACGGTACCTGCTCTCTGACCCCAGCACACCTCTGTCGCCTCCAGGCCCTGGGGACGTC

TTTTTCCCATCCCTAG ATCCAGTCCCTGACTCCCCTAACTCTGAAGCCATCTAAACCAGCTGGGGAACCATGAACCATGGTACCTGGGTCAGGGATATG

TGCACTTGATCTATGGCTGGCCCTTGGACAGTCTTTTAGGCACTGACTCCAGCTTCCTTGCTCCTGCTCTGAGCCTAGACTCTGCTTTTACAAGATGCAC

AGACCCTCCCCTATCTCTTTCAGACGCTACTTGGGGGGCAGGGAGAAGATGTTGGATTGCTCATTGCTGTTCTCAAGATCTTGGGATGCTGAGTTCTCCC

TAGAGACTTGACTTCGACAGCCACAGATGTCAGATGACCTGCATCCTATGAACGTCCGGCTTGGCAAGAGCCTTTCTTCATGGAAACCAGTAGCCCGGAG

GGGATGAGG
Translation
 - UNI31798 - MCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQV

QAG GKGSGSTCMASNEQDSDS SITAAALATGACIVGILCLPLILLLVYKQRQVASHRR RAQELVRMDS SNTQGIENPGFETTPPFQGMPEAKTRPP

LSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLD DPVPDSPNSEAI
Transcript ENSMUST00000105460
Sequence
GGGGGCGCTGCTGGGCGGGGAGCTTGCTCGGCCGCCTGCCTCGCCTTGGGCTCAGCATTCACTCTAGCGAGCGAGCGGCGTGTACAGCCGGCTCCCTGGG

CTCCTGGAGTCCCGCTTGCTCCAAGCGCACTCCAGCAGTCTCTTTCTGCTCTTGCCCGGCTCGACGGCGACATGGGTGTCCCCGCGGTCCCAGAGGCCAG

CAGCCCGCGCTGGGGAACCCTGCTCCTTGCTATTTTCCTGGCTGCATCCAGAG - UNI31798 - GTCTGGTAGCAGCCTTCAAGGTCACCACTCCAT

ATTCTCTCTATGTGTGTCCCGAGGGACAGAATGCCACCCTCACCTGCAGGATTCTGGGCCCCGTGTCCAAAGGGCACGATGTGACCATCTACAAGACGTG

GTACCTCAGCTCACGAGGCGAGGTCCAGATGTGCAAAGAACACCGGCCCATACGCAACTTCACATTGCAGCACCTTCAGCACCACGGAAGCCACCTGAAA

GCCAACGCCAGCCATGACCAGCCCCAGAAGCATGGGCTAGAGCTAGCTTCTGACCACCACGGTAACTTCTCTATCACCCTGCGCAATGTGACCCCAAGGG

ACAGCGGCCTCTACTGCTGTCTAGTGATAGAATTAAAAAACCACCACCCAGAACAACGGTTCTACGGGTCCATGGAGCTACAGGTACAGGCAG GCAAAG

GCTCGGGGTCCACATGCATGGCGTCTAATGAGCAGGACAGTGACA GCATCACGGCTGCGGCCCTGGCCACCGGCGCCTGCATCGTGGGAATCCTCTGCC

TCCCCCTTATCCTGCTGCTGGTCTATAAGCAGAGACAGGTGGCCTCTCACCGCC GTGCCCAGGAGTTGGTGAGGATGGACAG CAACACCCAAGGAATC

GAAAACCCAGGCTTCGAGACCACTCCACCCTTCCAGGGGATGCCTGAGGCCAAGACCAGGCCGCCACTGTCCTATGTGGCCCAGCGGCAACCTTCGGAGT

CAGGACGGTACCTGCTCTCTGACCCCAGCACACCTCTGTCGCCTCCAGGCCCTGGGGACGTCTTTTTCCCATCCCTAG ATCCAGTCCCTGACTCCCCTA

ACTCTGAAGCCATCTAAACCAGCTGGGGAACCATGAACCATGGTACCTGGGTCAGGGATATGTGCACTTGATCTATGGCTGGCCCTTGGACAGTCTTTTA

GGCACTGACTCCAGCTTCCTTGCTCCTGCTCTGAGCCTAGACTCTGCTTTTACAAGATGCACAGACCCTCCCCTATCTCTTTCAGACGCTACTTGGGGGG

CAGGGAGAAGATGTTGGATTGCTCATTGCTGTTCTCAAGATCTTGGGATGCTGAGTTCTCCCTAGAGACTTGACTTCGACAGCCACAGATGTCAGATGAC

CTGCATCCTATGAACGTCCGGCTTGGCAAGAGCCTTTCTTCATGGAAACCAGTAGCCCGGAGGGGATGAGGTAGGCACCTTGCCACCCTCCCGGGAGAGA

GACACAAGATGTGAGAGACTCCTGCTCACTGTGGGGGTGTGGCTGGCCTGCTTGTTTGCCTGAGGATGCTCCTCTGTTGGACTGACTCTATCCCCCTGGA

TTCTGGAGCTTGGCTGGCCTATGTCCCACCAGAGGAGCATCTCAGCAGCCTTCCACCAGCAACCTGAGGGCCTGCCAGCTTCGTGGCTCTGGGCTCTCAT

TACCTGTATGGCCGTCCACAGAGCTCAGTGGCCAGAGGCTTTGAAACAGGAAGTACATGTCAGGTTCAGGAACCACTGTGAGCTCATTAGTGTCTTGAGC

AATGTGAGGCCTGGACCAGTGGACACGGAGGGAGGGTGGCGAGAGGATGATGGGGATGATGAGGGGAACACGCTCCCTTCCTGTCCTTGTCATCCACCAC

TACCACTATTCAGTGTGGAGCAGTGGCAAAGGTGACCGACCTCCACAATGTCCTAGTGATGCTGGACCATTTCTAAGTGTGAAAGAGATGCTATTAAAAA

CAGTATGTGGCAATGGCTGCCAACAGCTGAGTGGACTGGAGGCACTGGCTTTAAGGCCCTGGAGGTGCAGGGCCCGGTATGGGGATAGGGATGGGAGTTT

CAGTGAGGGCCTAGGGATCACTCCGCTTCTGACCACTCTTCTTCTGAGCCTCACCTCAGGGTGACCTTCAGGCACACAGAAGAGCTTGCCCCTGGTCCGA

TACTACTCTTGGCTCTCATCTCCAGGGTTTGGCATGACCTGGGCACACAGGGGGAGTCTTCAGAAAGGATTTTAAAGCATGAAAAGAAAGGGTAGTTCTT

GTGAGGTAGGGATGGGCAGCTGATGTTTGAGAGTGAGGAGGGATACGGCTGGGCAGATCACTCTCCAGTCTCTAGAGGGAAAGTAGCTCTAAGTCTGGGA

GAGCAGCAGCCCAGTGGTACCATATGTCTTCTTGCAGCTTCCACTGGCTGGGCTGAACTGGGCATGGGTAGGAAAGCTCCTGTTCTGGGCCTGCAGCCAG

GGAGAACCCCATTCATTCCCTGAGGACAGATGGGTGGGGAGAGAAGAGAGAGTTTCAGGCCGGGAAGCAGCAATAAGCTATCTGCTGGGGACCCAGACAA

GTTGTCTGATGAGGTCCAAGATGTGGGATGCCAGTTATACCTGGGGCTTGGGGATCCTTAGAGGCTTTGTATCATCATCATAGGAGTGTCGGGGTGGCCA

GGGCATCAAAGCCATGACCCCTGTTTTATCCTCAGGGTCCACTCTTCTGCACCATCCATTGCTCTAGATCTATGCAGTTACTATAGACAGAATGTGTTGT

TCTGTTTGGCTTTGGGGATAATGGCCTGGCGAACTGCCAGCTGTTCAGTGGCAGGGCTGTGAGGCCAGTCAAAGACTAGAACCCACAGACCAGCTGAACG

ATGAGTATAGCCTGTCCCCTGGGGGAGCCTGACCTGTCTCCAGCCCTAAGCTTCAGACCTCACCACTCAGATGACTTCTAAGAATTTGCCTGTGGGGACC

CCTGCATGGCTGCAGCTCCGTGGAAAGGAGAGGAGGCCCCCAGCAGAAGAACCACTCGCTTCCTGCCCAGCTTCCTCCTGTAGGGCTCTAAGTCTCTTCT

TCTTGGGACCCTGCAAGCAAAGGCATGTCAGCTTGGTGGTTTCCTGTTTTGGGTGAAGTTTTGTGTGGTCCGGGTTCTGTCTACATCCATGAACTTGGGT

GCTACCACCTTGCTGCTGCTGTAGAGACAGCTGCAGGATCTTAGGGTGGAAAATGGAGGTGCCCTGAGGTGCTAGCCCTTGGGGCAAAAGATGGGGTGGC

AATGAGACACAGTGGGGAACTGAGTTCCCCAAGAGGAGGGAGGAGCCCTGTAGCCTCAAGGGCCATATTGGGTTCCTGGTACCAGCAAAAGCCTAGAGAG

CGAAGTCTGTATTTTGAGGAGGTAATTGATCCTTACGGAATCCATCAGAAATTTGGAGCGGGTGCTTTATCTATCTCTGGAGGGTCTCTACCTATCTCCG

ATGAAGCTCTCCCTGGGCCTGGGATGGGAGAAACCAGGAGGAAAGGTGTCTGATAAAGCAGGGGCTTCTTGACAAGCCAAAGGGCCACTGGTAGCTGTTG

TGGACCGAGCTGACCCTGCTGAAGTATTGTAGTGTGCCTTGGACCAACTTCTCAAAAGAGCAACCCCGGGGCTACCCTACTTCTGCCAGGAAGAGGCGGA

GAAGGGGCTGAGAGGCCTGGAAGGGGCTAGCTCCTTCTTTGAGAACTGCTCCCCGGAGGACTTGGAGGAGGCGGCTAGGCTACGGGCTGCTGAGGGCCCT

TTGTCTTTCCTAACCTGGGCACTGTTAGGATGCTCCCTCCTGGAAAAGGCTTTCCTGGGTGTGAGCTAGAGCAGTGTCCATGCCAGCGCTGAACCTGCCA

TGGTGGGAGCTGAACTAAAAATTTCTCAGGGAACTAAAATAGGCAAAAGAGGAACTGGGGGAGGAGGGTGCCAGGCAGGATGGGGGGAAGGGAGGGCAGT

GCAAAAGTCTCTTGAAACACAGACAGCCCAGCTGAGTGCCAGTCCCAGATCACAGAGAATACGGCTCATCTGGCTCATGTTCTGCATGCTTGCTGCTTTA

CCCTGGCACTTTCCTTCTCCACCATGAGTGCGAGTCCTGGGAGTCCTGGGAGGGTGAGGATTAATGCCAGCCTGGGGAGCAGATAGCTGACAGAGTCCTT

GGGTAACTGGCTTGAACCAGGACCTCAGGATTCCACTCTGGGGATCTAGCTTTGTCTGGGCCAGTGAAGATCTCTATAATGGCATTATTGCCAGGGGATA

AACATTTCACTGGGTTCTGATCTGTTGGGTGTGGCTTCCTGGAAAATATGGTGAGAGGAATTCTGCTAAGGATACAGTTGATAAGAAAGTTCTGAGATTG

ATTAGTAATGCCTGCCTTGGACTCAGGAAGGGAAGTGGCAGTATGAATGCCATGTCTTAATCATTTTGGTTAAAATATGCTTCCCAAAAGATTTCCACGT

GTGTTCTTGTTTATTTGACATCTGTCTCCATATCAGTCTTGAAAGCCTTTCTGTGTGTATATATATGATGTTTGCGTGTATATATGTTTTTGTGTGTGCA

TATGGAAGTCAGAAATCACTGGGTGTCTTCCTCCATTCCTTTGCAATGTATGTTTTTTTTTTTTTTACGATTTATTTACTATATGAATGTTTTGCCTGAA

TACATGCATAGGTGTCACGTACATGCCTGCTGGAACGCTTGGAACTGGAGTTACAGGTGGCTATGAGCTACAGTGTGAGCACTGGGAATCAAACCTGGGT

CTTCTGCAAGAGCAACAAATTAAAAGTCAGCTCTTAACTACTTGAGCTATTTTTCCAACTCC
Translation
MGVPAVPEASSPRWGTLLLAIFLAASRG - UNI31798 - GLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKE

HRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAG GKGSGSTCMASNEQ

DSDS SITAAALATGACIVGILCLPLILLLVYKQRQVASHRR RAQELVRMDS SNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLS

DPSTPLSPPGPGDVFFPSLD DPVPDSPNSEAI
Transcript ENSMUST00000020301
Sequence
AGCATTCACTCTAGCGAGCGAGCGGCGTGTACAGCCGGCTCCCTGGGCTCCTGGAGTCCCGCTTGCTCCAAGCGCACTCCAGCAGTCTCTTTCTGCTCTT

GCCCGGCTCGACGGCGACATGGGTGTCCCCGCGGTCCCAGAGGCCAGCAGCCCGCGCTGGGGAACCCTGCTCCTTGCTATTTTCCTGGCTGCATCCAGAG

 - UNI31798 - GTCTGGTAGCAGCCTTCAAGGTCACCACTCCATATTCTCTCTATGTGTGTCCCGAGGGACAGAATGCCACCCTCACCTGCAGGATT

CTGGGCCCCGTGTCCAAAGGGCACGATGTGACCATCTACAAGACGTGGTACCTCAGCTCACGAGGCGAGGTCCAGATGTGCAAAGAACACCGGCCCATAC

GCAACTTCACATTGCAGCACCTTCAGCACCACGGAAGCCACCTGAAAGCCAACGCCAGCCATGACCAGCCCCAGAAGCATGGGCTAGAGCTAGCTTCTGA

CCACCACGGTAACTTCTCTATCACCCTGCGCAATGTGACCCCAAGGGACAGCGGCCTCTACTGCTGTCTAGTGATAGAATTAAAAAACCACCACCCAGAA

CAACGGTTCTACGGGTCCATGGAGCTACAGGTACAGGCAG GCAAAGGCTCGGGGTCCACATGCATGGCGTCTAATGAGCAGGACAGTGACA GCATCAC

GGCTGCGGCCCTGGCCACCGGCGCCTGCATCGTGGGAATCCTCTGCCTCCCCCTTATCCTGCTGCTGGTCTATAAGCAGAGACAGGTGGCCTCTCACCGC

C GTGCCCAGGAGTTGGTGAGGATGGACAG CAGCAACACCCAAGGAATCGAAAACCCAGGCTTCGAGACCACTCCACCCTTCCAGGGGATGCCTGAGGC

CAAGACCAGGCCGCCACTGTCCTATGTGGCCCAGCGGCAACCTTCGGAGTCAGGACGGTACCTGCTCTCTGACCCCAGCACACCTCTGTCGCCTCCAGGC

CCTGGGGACGTCTTTTTCCCATCCCTAG ATCCAGTCCCTGACTCCCCTAACTCTGAAGCCATCTAAACCAGCTGGGGAACCATGAACCATGGTACCTGG

GTCAGGGATATGTGCACTTGATCTATGGCTGGCCCTTGGACAGTCTTTTAGGCACTGACTCCAGCTTCCTTGCTCCTGCTCTGAGCCTAGACTCTGCTTT

TACAAGATGCACAGACCCTCCCCTATCTCTTTCAGACGCTACTTGGGGGGCAGGGAGAAGATGTTGGATTGCTCATTGCTGTTCTCAAGATCTTGGGATG

CTGAGTTCTCCCTAGAGACTTGACTTCGACAGCCACAGATGTCAGATGACCTGCATCCTATGAACGTCCGGCTTGGCAAGAGCCTTTCTTCATGGAAACC

AGTAGCCCGGAGGGGATGAGGTAGGCACCTTGCCACCCTCCCGGGAGAGAGACACAAGATGTGAGAGACTCCTGCTCACTGTGGGGGTGTGGCTGGCCTG

CTTGTTTGCCTGAGGATGCTCCTCTGTTGGACTGACTCTATCCCCCTGGATTCTGGAGCTTGGCTGGCCTATGTCCCACCAGAGGAGCATCTCAGCAGCC

TTCCACCAGCAACCTGAGGGCCTGCCAGCTTCGTGGCTCTGGGCTCTCATTACCTGTATGGCCGTCCACAGAGCTCAGTGGCCAGAGGCTTTGAAACAGG

AAGTACATGTCAGGTTCAGGAACCACTGTGAGCTCATTAGTGTCTTGAGCAATGTGAGGCCTGGACCAGTGGACACGGAGGGAGGGTGGCGAGAGGATGA

TGGGGATGATGAGGGGAACACGCTCCCTTCCTGTCCTTGTCATCCACCACTACCACTATTCAGTGTGGAGCAGTGGCAAAGGTGACCGACCTCCACAATG

TCCTAGTGATGCTGGACCATTTCTAAGTGTGAAAGAGATGCTATTAAAAACAGTATGTGGCAATGGCTGCCAACAGCTGAGTGGACTGGAGGCACTGGCT

TTAAGGCCCTGGAGGTGCAGGGCCCGGTATGGGGATAGGGATGGGAGTTTCAGTGAGGGCCTAGGGATCACTCCGCTTCTGACCACTCTTCTTCTGAGCC

TCACCTCAGGGTGACCTTCAGGCACACAGAAGAGCTTGCCCCTGGTCCGATACTACTCTTGGCTCTCATCTCCAGGGTTTGGCATGACCTGGGCACACAG

GGGGAGTCTTCAGAAAGGATTTTAAAGCATGAAAAGAAAGGGTAGTTCTTGTGAGGTAGGGATGGGCAGCTGATGTTTGAGAGTGAGGAGGGATACGGCT

GGGCAGATCACTCTCCAGTCTCTAGAGGGAAAGTAGCTCTAAGTCTGGGAGAGCAGCAGCCCAGTGGTACCATATGTCTTCTTGCAGCTTCCACTGGCTG

GGCTGAACTGGGCATGGGTAGGAAAGCTCCTGTTCTGGGCCTGCAGCCAGGGAGAACCCCATTCATTCCCTGAGGACAGATGGGTGGGGAGAGAAGAGAG

AGTTTCAGGCCGGGAAGCAGCAATAAGCTATCTGCTGGGGACCCAGACAAGTTGTCTGATGAGGTCCAAGATGTGGGATGCCAGTTATACCTGGGGCTTG

GGGATCCTTAGAGGCTTTGTATCATCATCATAGGAGTGTCGGGGTGGCCAGGGCATCAAAGCCATGACCCCTGTTTTATCCTCAGGGTCCACTCTTCTGC

ACCATCCATTGCTCTAGATCTATGCAGTTACTATAGACAGAATGTGTTGTTCTGTTTGGCTTTGGGGATAATGGCCTGGCGAACTGCCAGCTGTTCAGTG

GCAGGGCTGTGAGGCCAGTCAAAGACTAGAACCCACAGACCAGCTGAACGATGAGTATAGCCTGTCCCCTGGGGGAGCCTGACCTGTCTCCAGCCCTAAG

CTTCAGACCTCACCACTCAGATGACTTCTAAGAATTTGCCTGTGGGGACCCCTGCATGGCTGCAGCTCCGTGGAAAGGAGAGGAGGCCCCCAGCAGAAGA

ACCACTCGCTTCCTGCCCAGCTTCCTCCTGTAGGGCTCTAAGTCTCTTCTTCTTGGGACCCTGCAAGCAAAGGCATGTCAGCTTGGTGGTTTCCTGTTTT

GGGTGAAGTTTTGTGTGGTCCGGGTTCTGTCTACATCCATGAACTTGGGTGCTACCACCTTGCTGCTGCTGTAGAGACAGCTGCAGGATCTTAGGGTGGA

AAATGGAGGTGCCCTGAGGTGCTAGCCCTTGGGGCAAAAGATGGGGTGGCAATGAGACACAGTGGGGAACTGAGTTCCCCAAGAGGAGGGAGGAGCCCTG

TAGCCTCAAGGGCCATATTGGGTTCCTGGTACCAGCAAAAGCCTAGAGAGCGAAGTCTGTATTTTGAGGAGGTAATTGATCCTTACGGAATCCATCAGAA

ATTTGGAGCGGGTGCTTTATCTATCTCTGGAGGGTCTCTACCTATCTCCGATGAAGCTCTCCCTGGGCCTGGGATGGGAGAAACCAGGAGGAAAGGTGTC

TGATAAAGCAGGGGCTTCTTGACAAGCCAAAGGGCCACTGGTAGCTGTTGTGGACCGAGCTGACCCTGCTGAAGTATTGTAGTGTGCCTTGGACCAACTT

CTCAAAAGAGCAACCCCGGGGCTACCCTACTTCTGCCAGGAAGAGGCGGAGAAGGGGCTGAGAGGCCTGGAAGGGGCTAGCTCCTTCTTTGAGAACTGCT

CCCCGGAGGACTTGGAGGAGGCGGCTAGGCTACGGGCTGCTGAGGGCCCTTTGTCTTTCCTAACCTGGGCACTGTTAGGATGCTCCCTCCTGGAAAAGGC

TTTCCTGGGTGTGAGCTAGAGCAGTGTCCATGCCAGCGCTGAACCTGCCATGGTGGGAGCTGAACTAAAAATTTCTCAGGGAACTAAAATAGGCAAAAGA

GGAACTGGGGGAGGAGGGTGCCAGGCAGGATGGGGGGAAGGGAGGGCAGTGCAAAAGTCTCTTGAAACACAGACAGCCCAGCTGAGTGCCAGTCCCAGAT

CACAGAGAATACGGCTCATCTGGCTCATGTTCTGCATGCTTGCTGCTTTACCCTGGCACTTTCCTTCTCCACCATGAGTGCGAGTCCTGGGAGTCCTGGG

AGGGTGAGGATTAATGCCAGCCTGGGGAGCAGATAGCTGACAGAGTCCTTGGGTAACTGGCTTGAACCAGGACCTCAGGATTCCACTCTGGGGATCTAGC

TTTGTCTGGGCCAGTGAAGATCTCTATAATGGCATTATTGCCAGGGGATAAACATTTCACTGGGTTCTGATCTGTTGGGTGTGGCTTCCTGGAAAATATG

GTGAGAGGAATTCTGCTAAGGATACAGTTGATAAGAAAGTTCTGAGATTGATTAGTAATGCCTGCCTTGGACTCAGGAAGGGAAGTGGCAGTATGAATGC

CATGTCTTAATCATTTTGGTTAAAATATGCTTCCCAAAAGATTTCCACGTGTGTTCTTGTTTATTTGACATCTGTCTCCATATCAGTCTTGAAAGCCTTT

CTGTGTGTATATATATGATGTTTGCGTGTATATATGTTTTTGTGTGTGCATATGGAAGTCAGAAATCACTGGGTGTCTTCCTCCATTCCTTTGCAATGTA

TGTTTTTTTTTTTTTTACGATTTATTTACTATATGAATGTTTTGCCTGAATACATGCATAGGTGTCACGTACATGCCTGCTGGAACGCTTGGAACTGGAG

TTACAGGTGGCTATGAGCTACAGTGTGAGCACTGGGAATCAAACCTGGGTCTTCTGCAAGAGCAACAAATTAAAAGTCAGCTCTTAACTACTTGAGCTAT

TTTTCCAACTCC
Translation
MGVPAVPEASSPRWGTLLLAIFLAASRG - UNI31798 - GLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKE

HRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAG GKGSGSTCMASNEQ

DSDS SITAAALATGACIVGILCLPLILLLVYKQRQVASHRR RAQELVRMDS SSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLL

SDPSTPLSPPGPGDVFFPSLD DPVPDSPNSEAI

For any suggestions or comments, please send an email to unitrap@crg.es