Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020109 (Dnajb12)
Chromosomal location
Chr 10: 59342374 - 59361269 (+)
Description
DnaJ (Hsp40) homolog, subfamily B, member 12 Gene [Source:MGI Symbol;Acc:MGI:1931881]
Human Ortholog
not available
Omim not available
UniTrap UNI38623
Vector Insertion
Chr 10: 59342559 - 59352775
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020309
Sequence
GCCCTTCGCTCGCCCGGCCTCCCCCTCCCTGGTTCCGTGCTCGGGTTCCGCCATGGAATCCAACAAGGATGAAGCCGAGCGCTGTATCAGCATCGCCCTC

AAGGCCATCCAAAGCAACCAGCCCGAGCGGGCGCTGCGCTTCCTGGAGAAGGCGCAGCGGCTCTACCCGACGCCACGAGTCAGCG - UNI38623 - C

ACTGATCGAGTCCCTCAACCAAAAACCACAGTCCACCGGTGATCACCCTCAACCCACAGACACTACCCATACCACCACCAAGAAGGCAGGCGGGACCGAA

ACCCCCTCAGCCAACGGCGAGGCAGGAGGAGGGGAGAGCGCCAAGGGCTATACCTCAGAGCAGGTGGCAGCTGTGAAAAG GGTCAAGCAGTGTAAAGAT

TACTATGAGATCCTTGGGGTAAGCAGAAGTGCCTCAGATGAGGACCTAAAGAAGGCCTACCGCAAGCTGGCCCTCAAGTTCCATCCAGACAAGAACCATG

CGCCTGGGGCCACTGAAGCTTTCAAAG CCATTGGCACAGCGTATGCCGTACTCAGCAACCCAGAGAAAAGGAAACAGTACGACCAGTTTGGTGATGACA

AGAGCCAGGCTGCCCGGCACGGCCACAGCCACGGGGACTTCCACCGAGGCTTTGAGGCTGACATCTCCCCAGAAGACCTCTTTAACATGTTCTTTGGTGG

CGGCTTTCCTTCCA GTAACGTTCATGTCTACAGCAATGGCCGAATGCGGTACACCTACCAGCAGAGGCAAGACCGCAGAGACAACCAGGGTGAT GGCG

GGCTAGGAGTGTTCGTGCAGCTGATGCCCATCCTCATCCTCATCCTCGTGTCTGCGCTCAGCCAGCTCATGGTGTCCAGTCCTCCCTACAGCCTGAGCCC

GAGACC GTCAGTGGGCCACATCCACAAGCGAGTCACTGACCACCTGAACGTCGCCTACTACGTGGCAGACACCTTCTCCGAAGAGTACACGGGCTCCAG

CCTCAAAACAGTGGAACGGAATGTAGAGGATGACTACATCGCCAACCTGCGCAACAACTGCTGGAAGGAGAAGCAGCAGA AGGAAGGCTTGCTGTACCG

AGCCCGCTACTTTGGTGACACAGACATGTACCACAGAGCACAGAAGATGGGCACCCCGAGTTGCAATCGGCTGTCAGAGGTGCAGGCCTCCCTGCATGGA

TAGTTCTGGGCCAGCCACACCACCCAG ACTATGAAATCCCTGGAGAATTTTTGGTGACACACACTGAGCCAGCCACAGTGATGGACTGTATATTTAAGG

AAAGACATACACAGAAAAAATTTAAATGGAACTGGAAGCCAAACACCGCACAGCCATCCTCTCTCAGACAGTGAATGCAGAAAGCTCTTAGGACAGACAG

ACAGACAGCCTACCTCGGGCTGCTTCCTCCTCTCCCAGGGCAGGCAAGAAGCTCCGCATCACTGGCTCCTAGGATACCGAAACCATGGCAACGAAAGTAG

AATGTAAAACTTGCAGCAAATGTCTGTGGGGAAGGACTGGGGGAGGGGACACCCCACTGTGTCTCCTCCCTCCTCCCTGAGCTGCCACCAGTCACTCAAG

GAGAAATCAGGCTGAGGCATGGGCCAAGGAACAGAGAGGAGAGAATTCCAGAGAACGTAACTTAGAAATGCGTATGTATGTATATATATATCTATTTATA

TGTAAATAGACATATATAAAGATATATATATATATATAAAGTCTTTTAAAACTATTCAGGGATTCAATTAAGATGTTCAGCTGACTTGCTCCATAATTTA

GAAAACGGGGCCTGTTTGGGAAGGCAGCCTGGTTTTCACAAGCTAGACAGTAGCCGTAGCCGACAGCATACGGAAAGTCAAATCAGATATTAGTGTCGCC

CTTAGCCCCAGCCTGACTGATGGCAGCAGTAATCATGGTGGTATAAATCCATAGAAAACTTGCAAAGGTCTCCAGGCTTATGGTTAAGGTAGGGGAAGAG

CCTGGGGCAGGGAATGGTGCCCCTGGAGATAGCTGCTCAGTATTGGGCTACAGCAGAGATCCCAGACAAAGCCCTCTGGGATGGGGCCAGCTCCTCAAGC

TGCCTCCTCTCTGGCCAGCCTCAGGTGGGCTCGCCGCCCTCATGCCCGGGAGCCCTGCAGCCACTCCCCTGCCCATACCTCTTCCCCACCCAAGTCCCCA

GGTGGGTTTGCCTTACAGGTGCCACAGGGCACAGCTCCACCATTGCCAACAGGTTTTCT
Translation
MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA - UNI38623 - ALIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGE

AGGGESAKGYTSEQVAAVKR RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKA AIGTAYAVLSNPEKRKQYDQFGDDKSQA

ARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSS SNVHVYSNGRMRYTYQQRQDRRDNQGD GGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPR

P PSVGHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQK KEGLLYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASL

HG 

For any suggestions or comments, please send an email to unitrap@crg.es