Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020128 (Vps54)
Chromosomal location
Chr 11: 21139284 - 21221136 (+)
Description
vacuolar protein sorting 54 (yeast) Gene [Source:MGI (curated);Acc:Vps54-001]
RefSeq_dna
NM_139061 
RefSeq_peptide
NP_620692.2 
UniGene
Mm.404035 Mm.170103 
MGI
MGI:2178798 
Uniprot/SWISSPROT
Q5SPW0 
Uniprot/SPTREMBL
Q3UVJ8 Q8BRE9 Q5SRW8 Q91ZJ4 
Human Ortholog
ENSG00000143952 (VPS54)
Omim not available
UniTrap UNI18165
Vector Insertion
Chr 11: 21139375 - 21163201
Public Clones (sanger) E326F07 (ggtc) D052D03 (ggtc) D155E04 (ggtc) D064H01 (ggtc)
5SE311C07 (ggtc) E121D06 (ggtc) D153B05 (ggtc) D058G11 (ggtc) 3SE311C07 (ggtc)
D101C07 (ggtc) CMHD-GT_260D11-3 (cmhd) IST14917H7 (tigm) IST11907A6 (tigm)
IST14351A3 (tigm) IST11584A11 (tigm) IST11755D11 (tigm) IST11440D12 (tigm)
IST12667D7 (tigm) IST13055H7 (tigm) IST14374H8 (tigm) IST10810C7 (tigm)
IST10170A12 (tigm) IST10484C11 (tigm) IST12972G4 (tigm) IST11423A7 (tigm)
IST15099F12 (tigm) IST12643E7 (tigm) IST14166D7 (tigm) IST12312G5 (tigm)
IST11988A3 (tigm) IST11907E6 (tigm) IST11688D10 (tigm) IST15103B3 (tigm)
IST12338H1 (tigm) IST11784A1BBF1 (tigm) IST10853H4 (tigm) IST14981E9 (tigm)
IST10097H12 (tigm) IST14551F10 (tigm) IST14824B1 (tigm) IST12122A10 (tigm)
IST11749A1 (tigm) IST14332A1 (tigm) IST11908B6 (tigm) IST11907D7 (tigm)
IST10157E7 (tigm) IST12312A7 (tigm) IST10232B7 (tigm) IST11153F4 (tigm)
IST10908D9 (tigm) IST12145G12 (tigm) IST10815G9 (tigm) IST12040H7 (tigm)
IST14641A2 (tigm) IST11568B8 (tigm) IST11316D6 (tigm) IST14479F7 (tigm)
IST14332E11 (tigm) IST14945F12 (tigm) IST13069C10 (tigm) IST10669E12 (tigm)
IST14584G1 (tigm) IST14100F1 (tigm) IST12596C10 (tigm) IST13638H5 (tigm)
IST14111D8 (tigm) IST13053G2 (tigm) IST13035G7 (tigm)
Private Clones OST428595 (lexicon) OST412392 (lexicon) OST394877 (lexicon) OST389789 (lexicon)
OST389112 (lexicon) OST388529 (lexicon) OST379993 (lexicon) OST378462 (lexicon)
OST377708 (lexicon) OST369719 (lexicon) OST354030 (lexicon) OST345941 (lexicon)
OST327159 (lexicon) OST297635 (lexicon) OST295210 (lexicon) OST293140 (lexicon)
OST288146 (lexicon) OST285137 (lexicon) OST285127 (lexicon) OST279924 (lexicon)
OST270262 (lexicon) OST219539 (lexicon) OST215205 (lexicon) OST192834 (lexicon)
OST192813 (lexicon) OST185470 (lexicon) OST183499 (lexicon) OST179258 (lexicon)
OST179205 (lexicon) OST175183 (lexicon) OST175170 (lexicon) OST172345 (lexicon)
OST166292 (lexicon) OST165879 (lexicon) OST158792 (lexicon) OST148694 (lexicon)
OST148121 (lexicon) OST147545 (lexicon) OST144940 (lexicon) OST142939 (lexicon)
OST142863 (lexicon) OST129230 (lexicon) OST124458 (lexicon) OST116637 (lexicon)
OST114800 (lexicon) OST108788 (lexicon) OST104256 (lexicon) OST103210 (lexicon)
OST102631 (lexicon) OST100656 (lexicon) OST93110 (lexicon) OST83011 (lexicon)
OST73292 (lexicon) OST67689 (lexicon) OST65829 (lexicon) OST63825 (lexicon)
OST63620 (lexicon) OST61576 (lexicon) OST40175 (lexicon) OST40104 (lexicon)
OST38015 (lexicon) OST36681 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32234
Vector Insertion
Chr 11: 21163358 - 21164632
Public Clones IST10733G1 (tigm) IST11152C4 (tigm) IST10408A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34929
Vector Insertion
Chr 11: 21164875 - 21168787
Public Clones IST11533D7 (tigm) IST11529D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8010
Vector Insertion
Chr 11: 21168867 - 21171706
Public Clones RRI497 (baygenomics) IST10458G12 (tigm) IST14096B3 (tigm) IST14329D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21249
Vector Insertion
Chr 11: 21171742 - 21175000
Public Clones IST12770D4 (tigm) IST10074B3 (tigm)
Private Clones OST337095 (lexicon) OST40106 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33026
Vector Insertion
Chr 11: 21178064 - 21191035
Public Clones IST12461H4 (tigm) IST10465H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14360
Vector Insertion
Chr 11: 21205784 - 21206368
Public Clones FHCRC-GT-S16-9D1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109578
Sequence
GCGGCCGCGGAGCAGCAGTCTCGGCGCGACGTGGAGGGATGGAGGCGGCGGTGCACTAGGCCTCGTCTGGGGCTGCCGCCCGGGACCGCAG - UNI181

65 - TTGAGTGGTGATTTTATGCAATGGCTTCAAGCCACAGTTCTTCTCCAGTGCCTCAAGGAAGCAGCAGTGATGTTTTCTTTAAAAAAGAGGTAGAT

CCAACAAAACACATTCGACCTGTGCAGTCACTGCCAGATGTGTGTCCCAAGGAACCCACAG - UNI32234 - TTACAGATCAACATAGATGGACTGT

GTATCATTCCAAAGTAAATCTCCCAGCAGCATTAAATGATCCTACACTAGCAAAAAGAGAATCTGACTTCTTCACAAAAACTTGGGGATTGGACTTTGTG

GACACTGAAGTCATACCTTCACTCTACCTCCCACAGATCAGCAAGGAGAATTTTATAGCATATCAGCAGGAGATCTCTCAG AGAGAGAAGATTCATGAG

AGATGCAAGAATATTTGTCCTCCTAAAGATACCTTTGACAGGACTCTTTTACATATTCATG - UNI8010 - ATAAATCCAGGACAGATCTGGAGCAA

GTACCTAAG - UNI21249 - ATTTTTATGAAACCAGATTTTGCCTTGGATGATTCTTTAACTTTTAATTCAGTTTTACCATGGTCTCATTTTAATAC

TGCTGGTGGGAAAGGAAGTCGCGACGCAGCTTCTTCCAAGTTGCTTCAGGAAAAG CTGAGCCATTATCTGGATATTGTGGAAGTAAACATTGCTCACCA

GATCTCTCTACGTTCAGAAGCATTTTTTCATGCAATGACCTCTCAACACGAATTGCAGGACTACCTCAAGAAAACTACCCAGGCTGTAAAAATGCTTCGA

GATAAAATTGCACAGATTGATAAAGTTATGTGTGAAGGATCACTACAGATTTTAAGACTGGCACTTACCAGAAATAATTGTGTTAAAGTATACAATAAAC

TGAAGTTAATGGCCACTGTACACCAAACTCAGCCTACAGTGCAGGTGTTGTTATCTACTTCTGAATTTGTTGGAGCGTTGGACTTAATAGCAACAACTCA

AGAGGTTCTGCAGCAGGAGCTTCAGGGCATTCACAGCTTCCG - UNI33026 - GCATTTGGGATCACAGCTTTGTGAATTAGAAAAGCTGATTGATA

AAATGATGATTGCAGAATTTTCTACTTATTCTCATAGTGACTTAAATAGACCACTGGAAGGTGAATGCCAAGTTTTAGAAGAG GAAAGATTAGTATCTC

TTGTATTTGGGCTTTTGAAACAAAGAAAACTTAATTTTTTAGAAATCTATGGTGAAGAAATGATTATTACAGCAAAGAACATCATTAAAGAG CGTGTGA

TTAATAAAGTTTCACAAATAGAAGAAATAGACACAGACGTTGTTGTAAA GCTTGCAGATCAAATGAGAATGTTGAATTTTCCCCAGTGGATTGATCTGT

TAAAGGACATTTTCTCTAAGTTTACAGTTTTCCTACAGAGAGTTAAG GCAACATTGAATATTATCCACAGTGTTGTTCTGTCAGTTCTTGAGAAAAGCC

AAAGGACTAGAGAATTGGAAGAGATCCCACAGCAGAGGAGCGCTGGGAAGGACAGCTCCTTGGACACAGACGTGGCTTACCTGACACACGAGGGCTGGTT

CATAAGTGATGCTTTCAGTGAGGGTGAGCCAGCATCTGCGGCGGTTGATACTACCTCTCAAAGAAACACGTCTCCACATAGCGAGCCCTGCAGCAGTGAT

TCGGTATCAGAACCAGAATGTACTACTGATTCTTCATCCAGCAAGGAGCAGACATCAGCGTGTGCTCCTCCAGGAGGTATAGAGATTAT AGTCAGTGAA

GACATGAGGTTAACTGACTTGGAGCTAGGAAAACTAGCAAGTAACATCCAGGAGTTACTGTGTAATGCTTCAGATGTATGCCATGATCGAGCTGTCAAAT

TTCTCATGTCAAGAGCAAAG - UNI14360 - GACGGTTTTCTTGAAAAATTGAATTCCACGGAATTCATAGCACTCTCGAGATTAATGGAGACATTC

ATAGTGGACACTGAACAGATCTGTGGGAGGAAGAGCACGTCACTGCTTGGGGCCCTTCAGAGCCAAGCAAATAAGTTTGTGAACAGGTTTCATGAAGAGA

GGCGGACCAAGCTCAG CCTCCTCTTAGACAACGAGCGTTGGAAGCAGGCTGATGTTCCTGCAGAATTTCAGGATCTTGTTGATTCTATAGCGGATGGAA

AGATTGCTTTACCTGAAAAAAAGCCAGTGG TTACAGAAGAAAGGAAGCCAGCTGATGTTCTTGTTGTTGAGGGACACCAGTATGCAGTTGTCGG AACC

GTCTTGCTGTTAATAAGAATCATTCTTGAATATTGCCAGTGTGTGGATAACATCCCCTCCGTCACTACTGACATGCTCACTCGCCTGACAGATCTGCTGA

AG TACTTCAATTCAAGAAGTTGCCAGTTAGTTCTTGGAGCTGGTGCTTTGCAAGTTGTTGGACTAAAAACAATTACTACAAAAAACTTGG CCCTCTCT

TCACGGTGTCTGCAGTTGATTGTGCACTACATTCCCGTGATCCGGGCTCACTTTGAAGCCCGACTGCCCCCCAAGCAATGGAGCATGCTTAGACATTTTG

ATCACATCACAAAG GATTACCATGATCATATAGCTGAAATTTCAGCTAAGCTTGTAGCGATAATGGATAGCCTATTTGATAAGCTGTTATCAAAG TAT

GAGGTGAAAGCTCCTGTTCCTTCCCCGTGTTTCAGGAATATTTGTAAGCAAATGACAAAAATGCATGAAGCTATATTTGATCTTCTTCCCGAAGAACAAA

CACAG ATGTTATTTTTAAGAATTAATGCAAGTTACAAACTCCACTTGAAAAAACAGTTATCACACTTAAATGTAATAAATGACGGAGGACCTCAAAATG

G GTTGGTCACAGCAGATGTAGCTTTTTACACTGGAAATCTTCAAGCCTTAAAAGGCCTTAAAGATCTGGATCTAAATATGGCCGAGATCTGGGAACAGA

AGAGGTGATGACAGACTGGAGACCCAGGTCGTTCATCTGACCACGGGATGTGTTTCTGAAGAAAATCTGGATGCCTGGTGTGTTAGGAACTGAACCTGGG

ACCCAAAGTGACTGAGGTGGGGGAAGGGAAAAGAAGGATCAGTGTTGGGAACTGGATTCAGTGGGATCTACAGAGAAAGCCATTCTGTGCATCCCTGAGT

AAGGAGCAAGTGATCAGGTGTCTATAACATTTTTCATTCTCTCTGGAAACAGACTCAGGTTTCTTTGGACCAAATCCAAAAGAACACATAGCTGTAACAC

AGCTGTAGCTGCCTAGAATGCTCTGTATACTTTATATTAAAAATGCTCTGCATTTCTTCCAGTGCAATGAAATTCATATGGTGTCCCACCTTATTTAATG

ATGGTACAATTGAAAATATTAAAATCTTAGTCAACCTCTGTAGAAAGTTTTCTCTATGAAAGTAAAGCTGTTTGAGAAATTATTTTTTTACAGATCTTTA

TAAAAAATAAACATCTTTTGATTGCTTGGATTTAGGAATTCAGTTTTTGTTTTAATGACCAATGTCAAGTTTCAGGTTTTGTGTGCTGCATATTTAACTT

TTTCACTACCACTGTTATGTCACTGGGTAAAAGCCTCAAACTGTTAAATATATGGGAGACTGATTATAAAGAATAAAGAATATTTGCATTTACTTATGCA

ACTACTAATTTAAATACTTTCCAGAAGTGGGATACATAAAGCTATGGTTTAATAGCTGTATTTATTAAAGTACCTATGAAGGGTTTGGGGTAGCATTCTG

TTTTTTCTTTGCTTTTTCATTTCTAGCAGAGGCAAGAATACATATTCATATACGCTTACTTATGAATTACCATTTTAACATTTAGATAACATGAAATATG

GCCCTCTTGAATTCTTGCTTTTAAGTTCCTTTTGATATGTATATAAGCAAAGACCAGGGATAAATGGAATTTTTAAAATACAGGCTGCTGTGTTGGGGCC

AGAAATACAAGGTTGATGAGTAAGCTATCTGAAGACTTTTATAATGCCTACCTTCAAAACCAGAATCGGCAGCACTCTACAAATGAAAGTGCCTGTGTCT

CACACCAAGAATCTTGCCTAACCTGTCAGAGTGCCTAATCTTGTGGTTATAATGTACAATGAAATAATCTTGTGGGGGTTTTTTGTTTTCTCAAGAGGAA

TTTTTTTTTTTTATCATTGCAGAGGTATGTCATTGGTTCTTAAACTGTCAAAAATAAAGATGTACAAAAACA
Translation
 - UNI18165 - MASSHSSSPVPQGSSSDVFFKKEVDPTKHIRPVQSLPDVCPKEPTV - UNI32234 - VTDQHRWTVYHSKVNLPAALNDPTLA

KRESDFFTKTWGLDFVDTEVIPSLYLPQISKENFIAYQQEISQ REKIHERCKNICPPKDTFDRTLLHIHD - UNI8010 - DKSRTDLEQVPK - U

NI21249 - IFMKPDFALDDSLTFNSVLPWSHFNTAGGKGSRDAASSKLLQEK LSHYLDIVEVNIAHQISLRSEAFFHAMTSQHELQDYLKKTTQAVK

MLRDKIAQIDKVMCEGSLQILRLALTRNNCVKVYNKLKLMATVHQTQPTVQVLLSTSEFVGALDLIATTQEVLQQELQGIHSFR - UNI33026 - RH

LGSQLCELEKLIDKMMIAEFSTYSHSDLNRPLEGECQVLEE ERLVSLVFGLLKQRKLNFLEIYGEEMIITAKNIIKE RVINKVSQIEEIDTDVVVK K

LADQMRMLNFPQWIDLLKDIFSKFTVFLQRVK ATLNIIHSVVLSVLEKSQRTRELEEIPQQRSAGKDSSLDTDVAYLTHEGWFISDAFSEGEPASAAVD

TTSQRNTSPHSEPCSSDSVSEPECTTDSSSSKEQTSACAPPGGIEII IVSEDMRLTDLELGKLASNIQELLCNASDVCHDRAVKFLMSRAK - UNI14

360 - DGFLEKLNSTEFIALSRLMETFIVDTEQICGRKSTSLLGALQSQANKFVNRFHEERRTKLS SLLLDNERWKQADVPAEFQDLVDSIADGKIAL

PEKKPVV VTEERKPADVLVVEGHQYAVVG GTVLLLIRIILEYCQCVDNIPSVTTDMLTRLTDLLK YFNSRSCQLVLGAGALQVVGLKTITTKNLA A

LSSRCLQLIVHYIPVIRAHFEARLPPKQWSMLRHFDHITK DYHDHIAEISAKLVAIMDSLFDKLLSK YEVKAPVPSPCFRNICKQMTKMHEAIFDLLP

EEQTQ MLFLRINASYKLHLKKQLSHLNVINDGGPQNG GLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR
Transcript ENSMUST00000094375
Sequence
GCGGCCGCGGAGCAGCAGTCTCGGCGCGACGTGGAGGGATGGAGGCGGCGGTGCACTAGGCCTCGTCTGGGGCTGCCGCCCGGGACCGCAG - UNI181

65 - TTGAGTGGTGATTTTATGCAATGGCTTCAAGCCACAGTTCTTCTCCAGTGCCTCAAGGAAGCAGCAGTGATGTTTTCTTTAAAAAAGAGGTAGAT

CCAACAAAACACATTCGACCTGTGCAGTCACTGCCAGATGTGTGTCCCAAGGAACCCACAG - UNI32234 - GTGATTCACATACTTTATGTGTTGC

CCCATCTCTAGTTACAGATCAACATAGATGGACTGTGTATCATTCCAAAGTAAATCTCCCAGCAGCATTAAATGATCCTACACTAGCAAAAAGAGAATCT

GACTTCTTCACAAAAACTTGGGGATTGGACTTTGTGGACACTGAAGTCATACCTTCACTCTACCTCCCACAGATCAGCAAGGAGAATTTTATAGCATATC

AGCAGGAGATCTCTCAG AGAGAGAAGATTCATGAGAGATGCAAGAATATTTGTCCTCCTAAAGATACCTTTGACAGGACTCTTTTACATATTCATG - 

UNI8010 - ATAAATCCAGGACAGATCTGGAGCAAGTACCTAAG - UNI21249 - ATTTTTATGAAACCAGATTTTGCCTTGGATGATTCTTTAAC

TTTTAATTCAGTTTTACCATGGTCTCATTTTAATACTGCTGGTGGGAAAGGAAGTCGCGACGCAGCTTCTTCCAAGTTGCTTCAGGAAAAG CTGAGCCA

TTATCTGGATATTGTGGAAGTAAACATTGCTCACCAGATCTCTCTACGTTCAGAAGCATTTTTTCATGCAATGACCTCTCAACACGAATTGCAGGACTAC

CTCAAGAAAACTACCCAGGCTGTAAAAATGCTTCGAGATAAAATTGCACAGATTGATAAAGTTATGTGTGAAGGATCACTACAGATTTTAAGACTGGCAC

TTACCAGAAATAATTGTGTTAAAGTATACAATAAACTGAAGTTAATGGCCACTGTACACCAAACTCAGCCTACAGTGCAGGTGTTGTTATCTACTTCTGA

ATTTGTTGGAGCGTTGGACTTAATAGCAACAACTCAAGAGGTTCTGCAGCAGGAGCTTCAGGGCATTCACAGCTTCCG - UNI33026 - GCATTTGG

GATCACAGCTTTGTGAATTAGAAAAGCTGATTGATAAAATGATGATTGCAGAATTTTCTACTTATTCTCATAGTGACTTAAATAGACCACTGGAAGGTGA

ATGCCAAGTTTTAGAAGAG CGTGTGATTAATAAAGTTTCACAAATAGAAGAAATAGACACAGACGTTGTTGTAAA GCTTGCAGATCAAATGAGAATGT

TGAATTTTCCCCAGTGGATTGATCTGTTAAAGGACATTTTCTCTAAGTTTACAGTTTTCCTACAGAGAGTTAAG GCAACATTGAATATTATCCACAGTG

TTGTTCTGTCAGTTCTTGAGAAAAGCCAAAGGACTAGAGAATTGGAAGAGATCCCACAGCAGAGGAGCGCTGGGAAGGACAGCTCCTTGGACACAGACGT

GGCTTACCTGACACACGAGGGCTGGTTCATAAGTGATGCTTTCAGTGAGGGTGAGCCAGCATCTGCGGCGGTTGATACTACCTCTCAAAGAAACACGTCT

CCACATAGCGAGCCCTGCAGCAGTGATTCGGTATCAGAACCAGAATGTACTACTGATTCTTCATCCAGCAAGGAGCAGACATCAGCGTGTGCTCCTCCAG

GAGGTATAGAGATTAT AGTCAGTGAAGACATGAGGTTAACTGACTTGGAGCTAGGAAAACTAGCAAGTAACATCCAGGAGTTACTGTGTAATGCTTCAG

ATGTATGCCATGATCGAGCTGTCAAATTTCTCATGTCAAGAGCAAAG - UNI14360 - GACGGTTTTCTTGAAAAATTGAATTCCACGGAATTCATA

GCACTCTCGAGATTAATGGAGACATTCATAGTGGACACTGAACAGATCTGTGGGAGGAAGAGCACGTCACTGCTTGGGGCCCTTCAGAGCCAAGCAAATA

AGTTTGTGAACAGGTTTCATGAAGAGAGGCGGACCAAGCTCAG CCTCCTCTTAGACAACGAGCGTTGGAAGCAGGCTGATGTTCCTGCAGAATTTCAGG

ATCTTGTTGATTCTATAGCGGATGGAAAGATTGCTTTACCTGAAAAAAAGCCAGTGG TTACAGAAGAAAGGAAGCCAGCTGATGTTCTTGTTGTTGAGG

GACACCAGTATGCAGTTGTCGG AACCGTCTTGCTGTTAATAAGAATCATTCTTGAATATTGCCAGTGTGTGGATAACATCCCCTCCGTCACTACTGACA

TGCTCACTCGCCTGACAGATCTGCTGAAG TACTTCAATTCAAGAAGTTGCCAGTTAGTTCTTGGAGCTGGTGCTTTGCAAGTTGTTGGACTAAAAACAA

TTACTACAAAAAACTTGG CCCTCTCTTCACGGTGTCTGCAGTTGATTGTGCACTACATTCCCGTGATCCGGGCTCACTTTGAAGCCCGACTGCCCCCCA

AGCAATGGAGCATGCTTAGACATTTTGATCACATCACAAAG GATTACCATGATCATATAGCTGAAATTTCAGCTAAGCTTGTAGCGATAATGGATAGCC

TATTTGATAAGCTGTTATCAAAG TATGAGGTGAAAGCTCCTGTTCCTTCCCCGTGTTTCAGGAATATTTGTAAGCAAATGACAAAAATGCATGAAGCTA

TATTTGATCTTCTTCCCGAAGAACAAACACAG ATGTTATTTTTAAGAATTAATGCAAGTTACAAACTCCACTTGAAAAAACAGTTATCACACTTAAATG

TAATAAATGACGGAGGACCTCAAAATGG GTTGGTCACAGCAGATGTAGCTTTTTACACTGGAAATCTTCAAGCCTTAAAAGGCCTTAAAGATCTGGATC

TAAATATGGCCGAGATCTGGGAACAGAAGAGGTGATGACAGACTGGAGACCCAGGTCGTTCATCTGACCACGGGATGTGTTTCTGAAGAAAATCTGGATG

CCTGGTGTGTTAGGAACTGAACCTGGGACCCAAAGTGACTGAGGTGGGGGAAGGGAAAAGAAGGATCAGTGTTGGGAACTGGATTCAGTGGGATCTACAG

AGAAAGCCATTCTGTGCATCCCTGAGTAAGGAGCAAGTGATCAGGTGTCTATAACATTTTTCATTCTCTCTGGAAACAGACTCAGGTTTCTTTGGACCAA

ATCCAAAAGAACACATAGCTGTAACACAGCTGTAGCTGCCTAGAATGCTCTGTATACTTTATATTAAAAATGCTCTGCATTTCTTCCAGTGCAATGAAAT

TCATATGGTGTCCCACCTTATTTAATGATGGTACAATTGAAAATATTAAAATCTTAGTCAACCTCTGTAGAAAGTTTTCTCTATGAAAGTAAAGCTGTTT

GAGAAATTATTTTTTTACAGATCTTTATAAAAAATAAACATCTTTTGATTGCTTGGATTTAGGAATTCAGTTTTTGTTTTAATGACCAATGTCAAGTTTC

AGGTTTTGTGTGCTGCATATTTAACTTTTTCACTACCACTGTTATGTCACTGGGTAAAAGCCTCAAACTGTTAAATATATGGGAGACTGATTATAAAGAA

TAAAGAATATTTGCATTTACTTATGCAACTACTAATTTAAATACTTTCCAGAAGTGGGATACATAAAGCTATGGTTTAATAGCTGTATTTATTAAAGTAC

CTATGAAGGGTTTGGGGTAGCATTCTGTTTTTTCTTTGCTTTTTCATTTCTAGCAGAGGCAAGAATACATATTCATATACGCTTACTTATGAATTACCAT

TTTAACATTTAGATAACATGAAATATGGCCCTCTTGAATTCTTGCTTTTAAGTTCCTTTTGATATGTATATAAGCAAAGACCAGGGATAAATGGAATTTT

TAAAATACAGGCTGCTGTGTTGGGGCCAGAAATACAAGGTTGATGAGTAAGCTATCTGAAGACTTTTATAATGCCTACCTTCAAAACCAGAATCGGCAGC

ACTCTACAAATGAAAGTGCCTGTGTCTCACACCAAGAATCTTGCCTAACCTGTCAGAGTGCCTAATCTTGTGGTTATAATGTACAATGAAATAATCTTGT

GGGGGTTTTTTGTTTTCTCAAGAGGAATTTTTTTTTTTTATCATTGCAGAGGTATGTCATTGGTTCTTAAACTGTCAAAAATAAAGATGTACAAAAACAG

ACTTAAAAGG
Translation
 - UNI18165 - MASSHSSSPVPQGSSSDVFFKKEVDPTKHIRPVQSLPDVCPKEPTG - UNI32234 - GDSHTLCVAPSLVTDQHRWTVYHSKV

NLPAALNDPTLAKRESDFFTKTWGLDFVDTEVIPSLYLPQISKENFIAYQQEISQ REKIHERCKNICPPKDTFDRTLLHIHD - UNI8010 - DKSR

TDLEQVPK - UNI21249 - IFMKPDFALDDSLTFNSVLPWSHFNTAGGKGSRDAASSKLLQEK LSHYLDIVEVNIAHQISLRSEAFFHAMTSQHEL

QDYLKKTTQAVKMLRDKIAQIDKVMCEGSLQILRLALTRNNCVKVYNKLKLMATVHQTQPTVQVLLSTSEFVGALDLIATTQEVLQQELQGIHSFR - U

NI33026 - RHLGSQLCELEKLIDKMMIAEFSTYSHSDLNRPLEGECQVLEE RVINKVSQIEEIDTDVVVK KLADQMRMLNFPQWIDLLKDIFSKFT

VFLQRVK ATLNIIHSVVLSVLEKSQRTRELEEIPQQRSAGKDSSLDTDVAYLTHEGWFISDAFSEGEPASAAVDTTSQRNTSPHSEPCSSDSVSEPECT

TDSSSSKEQTSACAPPGGIEII IVSEDMRLTDLELGKLASNIQELLCNASDVCHDRAVKFLMSRAK - UNI14360 - DGFLEKLNSTEFIALSRLM

ETFIVDTEQICGRKSTSLLGALQSQANKFVNRFHEERRTKLS SLLLDNERWKQADVPAEFQDLVDSIADGKIALPEKKPVV VTEERKPADVLVVEGHQ

YAVVG GTVLLLIRIILEYCQCVDNIPSVTTDMLTRLTDLLK YFNSRSCQLVLGAGALQVVGLKTITTKNLA ALSSRCLQLIVHYIPVIRAHFEARLP

PKQWSMLRHFDHITK DYHDHIAEISAKLVAIMDSLFDKLLSK YEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQ MLFLRINASYKLHLKKQLS

HLNVINDGGPQNG GLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR
Transcript ENSMUST00000006221
Sequence
GCGGCCGCGGAGCAGCAGTCTCGGCGCGACGTGGAGGGATGGAGGCGGCGGTGCACTAGGCCTCGTCTGGGGCTGCCGCCCGGGACCGCAG - UNI181

65 - TTGAGTGGTGATTTTATGCAATGGCTTCAAGCCACAGTTCTTCTCCAGTGCCTCAAGGAAGCAGCAGTGATGTTTTCTTTAAAAAAGAGGTAGAT

CCAACAAAACACATTCGACCTGTGCAGTCACTGCCAGATGTGTGTCCCAAGGAACCCACAG - UNI32234 - GTGATTCACATACTTTATGTGTTGC

CCCATCTCTAGTTACAGATCAACATAGATGGACTGTGTATCATTCCAAAGTAAATCTCCCAGCAGCATTAAATGATCCTACACTAGCAAAAAGAGAATCT

GACTTCTTCACAAAAACTTGGGGATTGGACTTTGTGGACACTGAAGTCATACCTTCACTCTACCTCCCACAGATCAGCAAGGAGAATTTTATAGCATATC

AGCAGGAGATCTCTCAG AGAGAGAAGATTCATGAGAGATGCAAGAATATTTGTCCTCCTAAAGATACCTTTGACAGGACTCTTTTACATATTCATG - 

UNI8010 - ATAAATCCAGGACAGATCTGGAGCAAGTACCTAAG - UNI21249 - ATTTTTATGAAACCAGATTTTGCCTTGGATGATTCTTTAAC

TTTTAATTCAGTTTTACCATGGTCTCATTTTAATACTGCTGGTGGGAAAGGAAGTCGCGACGCAGCTTCTTCCAAGTTGCTTCAGGAAAAG CTGAGCCA

TTATCTGGATATTGTGGAAGTAAACATTGCTCACCAGATCTCTCTACGTTCAGAAGCATTTTTTCATGCAATGACCTCTCAACACGAATTGCAGGACTAC

CTCAAGAAAACTACCCAGGCTGTAAAAATGCTTCGAGATAAAATTGCACAGATTGATAAAGTTATGTGTGAAGGATCACTACAGATTTTAAGACTGGCAC

TTACCAGAAATAATTGTGTTAAAGTATACAATAAACTGAAGTTAATGGCCACTGTACACCAAACTCAGCCTACAGTGCAGGTGTTGTTATCTACTTCTGA

ATTTGTTGGAGCGTTGGACTTAATAGCAACAACTCAAGAGGTTCTGCAGCAGGAGCTTCAGGGCATTCACAGCTTCCG - UNI33026 - GCATTTGG

GATCACAGCTTTGTGAATTAGAAAAGCTGATTGATAAAATGATGATTGCAGAATTTTCTACTTATTCTCATAGTGACTTAAATAGACCACTGGAAGGTGA

ATGCCAAGTTTTAGAAGAG GAAAGATTAGTATCTCTTGTATTTGGGCTTTTGAAACAAAGAAAACTTAATTTTTTAGAAATCTATGGTGAAGAAATGAT

TATTACAGCAAAGAACATCATTAAAGAG CGTGTGATTAATAAAGTTTCACAAATAGAAGAAATAGACACAGACGTTGTTGTAAA GCTTGCAGATCAAA

TGAGAATGTTGAATTTTCCCCAGTGGATTGATCTGTTAAAGGACATTTTCTCTAAGTTTACAGTTTTCCTACAGAGAGTTAAG GCAACATTGAATATTA

TCCACAGTGTTGTTCTGTCAGTTCTTGAGAAAAGCCAAAGGACTAGAGAATTGGAAGAGATCCCACAGCAGAGGAGCGCTGGGAAGGACAGCTCCTTGGA

CACAGACGTGGCTTACCTGACACACGAGGGCTGGTTCATAAGTGATGCTTTCAGTGAGGGTGAGCCAGCATCTGCGGCGGTTGATACTACCTCTCAAAGA

AACACGTCTCCACATAGCGAGCCCTGCAGCAGTGATTCGGTATCAGAACCAGAATGTACTACTGATTCTTCATCCAGCAAGGAGCAGACATCAGCGTGTG

CTCCTCCAGGAGGTATAGAGATTAT AGTCAGTGAAGACATGAGGTTAACTGACTTGGAGCTAGGAAAACTAGCAAGTAACATCCAGGAGTTACTGTGTA

ATGCTTCAGATGTATGCCATGATCGAGCTGTCAAATTTCTCATGTCAAGAGCAAAG - UNI14360 - GACGGTTTTCTTGAAAAATTGAATTCCACG

GAATTCATAGCACTCTCGAGATTAATGGAGACATTCATAGTGGACACTGAACAGATCTGTGGGAGGAAGAGCACGTCACTGCTTGGGGCCCTTCAGAGCC

AAGCAAATAAGTTTGTGAACAGGTTTCATGAAGAGAGGCGGACCAAGCTCAG CCTCCTCTTAGACAACGAGCGTTGGAAGCAGGCTGATGTTCCTGCAG

AATTTCAGGATCTTGTTGATTCTATAGCGGATGGAAAGATTGCTTTACCTGAAAAAAAGCCAGTGG TTACAGAAGAAAGGAAGCCAGCTGATGTTCTTG

TTGTTGAGGGACACCAGTATGCAGTTGTCGG AACCGTCTTGCTGTTAATAAGAATCATTCTTGAATATTGCCAGTGTGTGGATAACATCCCCTCCGTCA

CTACTGACATGCTCACTCGCCTGACAGATCTGCTGAAG TACTTCAATTCAAGAAGTTGCCAGTTAGTTCTTGGAGCTGGTGCTTTGCAAGTTGTTGGAC

TAAAAACAATTACTACAAAAAACTTGG CCCTCTCTTCACGGTGTCTGCAGTTGATTGTGCACTACATTCCCGTGATCCGGGCTCACTTTGAAGCCCGAC

TGCCCCCCAAGCAATGGAGCATGCTTAGACATTTTGATCACATCACAAAG GATTACCATGATCATATAGCTGAAATTTCAGCTAAGCTTGTAGCGATAA

TGGATAGCCTATTTGATAAGCTGTTATCAAAG TATGAGGTGAAAGCTCCTGTTCCTTCCCCGTGTTTCAGGAATATTTGTAAGCAAATGACAAAAATGC

ATGAAGCTATATTTGATCTTCTTCCCGAAGAACAAACACAG ATGTTATTTTTAAGAATTAATGCAAGTTACAAACTCCACTTGAAAAAACAGTTATCAC

ACTTAAATGTAATAAATGACGGAGGACCTCAAAATGG GTTGGTCACAGCAGATGTAGCTTTTTACACTGGAAATCTTCAAGCCTTAAAAGGCCTTAAAG

ATCTGGATCTAAATATGGCCGAGATCTGGGAACAGAAGAGGTGATGACAGACTGGAGACCCAGGTCGTTCATCTGACCACGGGATGTGTTTCTGAAGAAA

ATCTGGATGCCTGGTGTGTTAGGAACTGAACCTGGGACCCAAAGTGACTGAGGTGGGGGAAGGGAAAAGAAGGATCAGTGTTGGGAACTGGATTCAGTGG

GATCTACAGAGAAAGCCATTCTGTGCATCCCTGAGTAAGGAGCAAGTGATCAGGTGTCTATAACATTTTTCATTCTCTCTGGAAACAGACTCAGGTTTCT

TTGGACCAAATCCAAAAGAACACATAGCTGTAACACAGCTGTAGCTGCCTAGAATGCTCTGTATACTTTATATTAAAAATGCTCTGCATTTCTTCCAGTG

CAATGAAATTCATATGGTGTCCCACCTTATTTAATGATGGTACAATTGAAAATATTAAAATCTTAGTCAACCTCTGTAGAAAGTTTTCTCTATGAAAGTA

AAGCTGTTTGAGAAATTATTTTTTTACAGATCTTTATAAAAAATAAACATCTTTTGATTGCTTGGATTTAGGAATTCAGTTTTTGTTTTAATGACCAATG

TCAAGTTTCAGGTTTTGTGTGCTGCATATTTAACTTTTTCACTACCACTGTTATGTCACTGGGTAAAAGCCTCAAACTGTTAAATATATGGGAGACTGAT

TATAAAGAATAAAGAATATTTGCATTTACTTATGCAACTACTAATTTAAATACTTTCCAGAAGTGGGATACATAAAGCTATGGTTTAATAGCTGTATTTA

TTAAAGTACCTATGAAGGGTTTGGGGTAGCATTCTGTTTTTTCTTTGCTTTTTCATTTCTAGCAGAGGCAAGAATACATATTCATATACGCTTACTTATG

AATTACCATTTTAACATTTAGATAACATGAAATATGGCCCTCTTGAATTCTTGCTTTTAAGTTCCTTTTGATATGTATATAAGCAAAGACCAGGGATAAA

TGGAATTTTTAAAATACAGGCTGCTGTGTTGGGGCCAGAAATACAAGGTTGATGAGTAAGCTATCTGAAGACTTTTATAATGCCTACCTTCAAAACCAGA

ATCGGCAGCACTCTACAAATGAAAGTGCCTGTGTCTCACACCAAGAATCTTGCCTAACCTGTCAGAGTGCCTAATCTTGTGGTTATAATGTACAATGAAA

TAATCTTGTGGGGGTTTTTTGTTTTCTCAAGAGGAATTTTTTTTTTTTATCATTGCAGAGGTATGTCATTGGTTCTTAAACTGTCAAAAATAAAGATGTA

CAAAAACAGACTTAAAAGG
Translation
 - UNI18165 - MASSHSSSPVPQGSSSDVFFKKEVDPTKHIRPVQSLPDVCPKEPTG - UNI32234 - GDSHTLCVAPSLVTDQHRWTVYHSKV

NLPAALNDPTLAKRESDFFTKTWGLDFVDTEVIPSLYLPQISKENFIAYQQEISQ REKIHERCKNICPPKDTFDRTLLHIHD - UNI8010 - DKSR

TDLEQVPK - UNI21249 - IFMKPDFALDDSLTFNSVLPWSHFNTAGGKGSRDAASSKLLQEK LSHYLDIVEVNIAHQISLRSEAFFHAMTSQHEL

QDYLKKTTQAVKMLRDKIAQIDKVMCEGSLQILRLALTRNNCVKVYNKLKLMATVHQTQPTVQVLLSTSEFVGALDLIATTQEVLQQELQGIHSFR - U

NI33026 - RHLGSQLCELEKLIDKMMIAEFSTYSHSDLNRPLEGECQVLEE ERLVSLVFGLLKQRKLNFLEIYGEEMIITAKNIIKE RVINKVSQI

EEIDTDVVVK KLADQMRMLNFPQWIDLLKDIFSKFTVFLQRVK ATLNIIHSVVLSVLEKSQRTRELEEIPQQRSAGKDSSLDTDVAYLTHEGWFISDA

FSEGEPASAAVDTTSQRNTSPHSEPCSSDSVSEPECTTDSSSSKEQTSACAPPGGIEII IVSEDMRLTDLELGKLASNIQELLCNASDVCHDRAVKFLM

SRAK - UNI14360 - DGFLEKLNSTEFIALSRLMETFIVDTEQICGRKSTSLLGALQSQANKFVNRFHEERRTKLS SLLLDNERWKQADVPAEFQD

LVDSIADGKIALPEKKPVV VTEERKPADVLVVEGHQYAVVG GTVLLLIRIILEYCQCVDNIPSVTTDMLTRLTDLLK YFNSRSCQLVLGAGALQVVG

LKTITTKNLA ALSSRCLQLIVHYIPVIRAHFEARLPPKQWSMLRHFDHITK DYHDHIAEISAKLVAIMDSLFDKLLSK YEVKAPVPSPCFRNICKQM

TKMHEAIFDLLPEEQTQ MLFLRINASYKLHLKKQLSHLNVINDGGPQNG GLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR

For any suggestions or comments, please send an email to unitrap@crg.es