Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020134 (Peli1)
Chromosomal location
Chr 11: 20991327 - 21050329 (+)
Description
pellino 1 Gene [Source:MGI (curated);Acc:Peli1-001]
RefSeq_dna
NM_023324 NM_030015 
RefSeq_peptide
NP_075813.2 
UniGene
Mm.408019 Mm.403029 
MGI
MGI:1914495 
Uniprot/SWISSPROT
Q8C669 
Uniprot/SPTREMBL
Q3TJA0 Q5SRW7 
Human Ortholog
ENSG00000197329 (PELI1)
Omim not available
UniTrap UNI22384
Vector Insertion
Chr 11: 20991682 - 21036048
Public Clones (sanger) 5SE053F05 (ggtc) 3SE053F05 (ggtc) IST14472D5 (tigm) IST14499D9 (tigm)
Private Clones OST298865 (lexicon) OST170461 (lexicon) OST148334 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24125
Vector Insertion
Chr 11: 21040697 - 21042558
Public Clones not available
Private Clones OST233843 (lexicon) OST86143 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101477
Sequence
CCAGGTTGCTGGCTTCCTTAGTTTCTCGTCTGGCATATATTAGTCAAAGGGAGCACAGAAAATTCAGTCTTCTTGTTCCCTAGATCCCGAAGTCCCTACT

GTTCTGCCTCTCTCAGATTTTTATATCTTCTTATATTTTTTTTTCATGTCTATTTATTATGTGCCTACATGTACCATGCTGTGCATGTCGAGGCCAAAGG

ACAGTTTGCAGCAATTGGTTCTTTCCTTTCACCACGTGAGGTCCCAGATCAAACCTCAGTCAAAGGTAAGCACCTTTACCCACTGAGCCATCCTGCCAGC

TCCCTCCCTTCGTATATTTAGAAAAAGCTTTCTATATCTGCTTACATTATTTTATCCAGGGTCTTTAATTATACTTTGTAGAAATAATAGGGAAATGGAC

AACTTTGTTCAGTAAAGTGGCAGACAGACAAATGTACATTTATCTGTTTGTGTCAAATACAGAACCATTGACATGTGTTTCATGTGATTTTCTTGCTGTG

TTCATGAAGACTTGGAAAATACTCTATTTAAACTGGAATCATTGTTCATGTTATTAACAAAACCTTTTTCTCTTTAGGAAATAATGCAAAAGGTGTCTCA

AGGCTCCTGACCAGTGAACAGAGATTTGAGAAAGACAGCCAAGCTCATGTTTTCTCCTGATCAAGAAAATCATCCTTCCAAAGCCCCAGTAAAATATGGC

GAACTCATTGTCTTAGG ATATAATGGATCTCTCCCAAACGGTGATAGAGGAAGGAGGAAAAGTAGGTTTGCTTTGTTTAAAAGACCTAAGGCAAATGGG

GTGAAGCCTAGCACCGTGCACATTGCATGTACTCCTCAGGCTGCCAAG - UNI24125 - GCAATAAGCAACAAGGACCAGCATAGCATATCATATAC

TTTATCTCGAGCCCAGACGGTGGTGGTTGAATATACTCATGACAGCAACACTGATATGTTTCAG ATTGGTCGGTCAACTGAAAGTCCTATTGATTTTGT

AGTAACTGACACCGTTCCTGGAAGTCAGAGTAATTCCGACACGCAGTCAGTACAAAGCACTATATCAAGATTTGCCTGTAGGATCATATGTGAGCGCAGT

CCCCCCTTTACAGCTCGGATTTATGCTGCAGGGTTTGATTCATCAAAAAACATCTTTCTTGGG GAGAAGGCTGCCAAGTGGAAGACATCTGATGGGCAG

ATGGATGGCTTGACCACTAATGGAGTTCTTGTGATGCATCCACGTAATGGGTTCACAGAAGACTCCAAACCTGGAATATGGAGAGAAATATCAGTATGTG

GGAACGTCTTCAGTCTGCGTGAAACCAGATCAGCTCAGCAGAGAGGAAAGATG GTGGAAATTGAAACCAATCAGCTACAAGATGGCTCCTTAATTGACC

TTTGTGGTGCAACCTTGCTGTGGCGTACTGCAGAAGGCCTTTCCCATACTCCTACTGTGAAGCACTTAGAAGCTTTAAGACAGGAGATCAATGCAGCTCG

GCCGCAGTGCCCTGTAGGGTTCAACACACTAGCCTTCCCCAGTATGAAGAGGAAGGATGTTGTAGATGAAAAGCAACCATGGGTATATCTAAACTGCGGC

CATGTCCATGGTTATCATAACTGGGGAAACAAAGAAGAACGTGACGGCAAAGATCGTGAATGTCCTATGTGTAGGTCTGTTGGTCCCTATGTCCCTCTGT

GGCTTGGATGTGAAGCTGGATTTTATGTGGACGCCGGCCCTCCCACCCATGCCTTTAGCCCCTGTGGGCACGTGTGTTCAGAAAAGACAACGGCTTACTG

GTCCCAGATCCCACTTCCTCATGGTACGCACACTTTTCATGCAGCCTGCCCCTTCTGTGCACATCAGTTGGCTGGTGAACAAGGCTATATCAGACTTATT

TTCCAAGGACCTTTAGACTAGCAGCTGTCCTCCAGGACTGCATTGTAAGTTTATAAGCTAAGTGATTGGGTTTGCTAACCGACCCCTTGTCCATGTAAGT

TTCTCTGCTCTGGTCATTTGCATTAAGATGAAGAATTTTTTAAATATTTATAAGCAATTTCTGAGAAAAATCTGGGAAACTCAAGCAAAGGAATTTTTGA

AAGTTCCAGACTTCTGAACTCTGAGTTTTGAAAATCTATTTTGAGAAAAAAAAGACATAGTTTAATTTGATGCCTTCCTTTGTTTAGTGTTCTTGAATCA

CCGCCCACCCTCAGTGTTGAGAGGTTGTGCTGTAGAACTGAGGGTCTGTTGGTTCAAACTATGTTAGTTTACAATTTGTTGCAGACATTGTAAAATACAG

CAACATGTATATTAATTTTTCTATTTATCTTTATCATAGAAAGTACCTTAGAATGTTGTGATAGGCTAGCATGGTAATGATGGTGTCACACATTTGGTGT

GAGTGGTAGGGTAGTGAGCACAAGGCTCAAAGGTTTGCAAAGTTAAGGAGAAAGACAGGAGAGCTTCCCCCCCCCCCAGCCCCATAATTAGGGGATATTT

CATAAAACCAGAATATTTCATAAAACCAGATTCATATTAATTACCATTGTCTAAAAGGTGTTTGTTTTTAACCATATTGACGTTAACCAGAAAATGGTTT

TTTTCCTTAATCTTTCTCTCAAGTGTAGTACTAGAACAAAAGTTAATGCTAAGAAACGTTTTATATGCTCCTTTGAATATGCAATTTAATCTAGATGATC

TATTTTTCTCCCATGATAACTGATCTGTTTTTAGTGCCAGCAACATTTGGCAAGTTTATTTTTTTGGATATAAACTGTGGTTCATCTGTTCACTGTTTCT

AAAAAAAAAAAGAAAAAAAAGAAAAAAGAAAAGAAAAAAGAAAAAAATCCTATGAGAAAGTGAAGAAATTAACAAGAAAATTACTTGATTTGCTCTAGAA

AAATTAAATAAAAAGTGTTTTGTTAATTATTCTGTATTTGGATTATTCCAGGCATTAGAACATCTAGAGCTGTAAAGGGTTGGCTGCAATGGTACCTCCC

TTTGTAGCCCAGCAGACCAGCCTTAACTGTGGGCTTGACTCCTCAGGAGCTGGCCTCAGTGTGACTCATGGAAATGTTTGCTTAGCGGATGAAAGTGAGG

ACACACCGCAGGGGCTGCTGTTCTCTTCCTCCATATGTGCTGTGCAGGACAGTTTCTTCTCACCGTAGCCTTTTTAAATGCACCAGAAGTACAGACAGTT

GCACTACACCAAACCCTTTCAACACTTGTAGAAATCAGCACACTGTAGATTAGACGGAATCATCTTTCAGTCCTTTGACTTCTTTTCCTTAAGTTTGAAA

AATTGTATAATAATTGACTACTGTCAAATTTTTGTATGTGGTAGTATAGCTTTAATTTATCTTACTACATTAACGTTTTGATTTTAAAAAATTAAAACAA

AAAAAGTCACTTAGAAGCCATGAACTATTTTATTTTATTGTCAATTTTTCTTGTTTTGAAAATTATCATTTGGGTTCACTCAGGAAATGCATGTCAAGAT

CTGTATTATAAGTTATCTGTGATGTATCAGTAGCTGCTGGTTATTACCCTTTTTTCAAGGAAATTTCGTTGATTTGAAGTTTTCTGGTTACAAACTTTGT

GACCAATGCAAGGAAACCAAGTCCTGTGTTGTGTTTTGTCATTTCTGTTGAGGCTCTATATTGTAGCTTAATTTTTATTTGCAATTAATTTATTCAAACT

AAGTAAATACTTTTCAAAATA
Translation
MFSPDQENHPSKAPVKYGELIVLG GYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAK - UNI24125 - AISNKDQHSISYTLSRA

QTVVVEYTHDSNTDMFQ IGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERSPPFTARIYAAGFDSSKNIFLG EKAAKWKTSDGQMDG

LTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKM VEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQ

CPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQ

IPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
Transcript ENSMUST00000093290
Sequence
AGTGACCCAAAGGCGGTTCGAGGCGGAGGGACCGTCGGGGGCGCCGCCGCCGCCTTCTCCAGCGCCAGCAACAGCAGCAGCAGCGGCAGCGACAACAGCA

GCAGCGGCAGCAGCGGCCGTGCGGCGCCACCGGATCTGCCTGCAGCCCGGGGAGCTCACCACAAAGCGGGCCCGAGCCTCCCTCTCTAGTCCGCGCTCGG

CTCTGCGTTCCACTCGGCCTCGCGGGGCTCGGCGGCTGGCGGGAAGGCGGCGGGCTCCGCTGGTGCCTGCGTTCAACCGGTGCTCGCGCCGCCCCCGCGC

CCCGGGTGTCCGTGCGGCGGGCCGAGCTGGCGTTCCGGCCACCAGCAGTCGTCCG - UNI22384 - GAAATAATGCAAAAGGTGTCTCAAGGCTCCT

GACCAGTGAACAGAGATTTGAGAAAGACAGCCAAGCTCATGTTTTCTCCTGATCAAGAAAATCATCCTTCCAAAGCCCCAGTAAAATATGGCGAACTCAT

TGTCTTAGG ATATAATGGATCTCTCCCAAACGGTGATAGAGGAAGGAGGAAAAGTAGGTTTGCTTTGTTTAAAAGACCTAAGGCAAATGGGGTGAAGCC

TAGCACCGTGCACATTGCATGTACTCCTCAGGCTGCCAAG - UNI24125 - GCAATAAGCAACAAGGACCAGCATAGCATATCATATACTTTATCTC

GAGCCCAGACGGTGGTGGTTGAATATACTCATGACAGCAACACTGATATGTTTCAG ATTGGTCGGTCAACTGAAAGTCCTATTGATTTTGTAGTAACTG

ACACCGTTCCTGGAAGTCAGAGTAATTCCGACACGCAGTCAGTACAAAGCACTATATCAAGATTTGCCTGTAGGATCATATGTGAGCGCAGTCCCCCCTT

TACAGCTCGGATTTATGCTGCAGGGTTTGATTCATCAAAAAACATCTTTCTTGGG GAGAAGGCTGCCAAGTGGAAGACATCTGATGGGCAGATGGATGG

CTTGACCACTAATGGAGTTCTTGTGATGCATCCACGTAATGGGTTCACAGAAGACTCCAAACCTGGAATATGGAGAGAAATATCAGTATGTGGGAACGTC

TTCAGTCTGCGTGAAACCAGATCAGCTCAGCAGAGAGGAAAGATG GTGGAAATTGAAACCAATCAGCTACAAGATGGCTCCTTAATTGACCTTTGTGGT

GCAACCTTGCTGTGGCGTACTGCAGAAGGCCTTTCCCATACTCCTACTGTGAAGCACTTAGAAGCTTTAAGACAGGAGATCAATGCAGCTCGGCCGCAGT

GCCCTGTAGGGTTCAACACACTAGCCTTCCCCAGTATGAAGAGGAAGGATGTTGTAGATGAAAAGCAACCATGGGTATATCTAAACTGCGGCCATGTCCA

TGGTTATCATAACTGGGGAAACAAAGAAGAACGTGACGGCAAAGATCGTGAATGTCCTATGTGTAGGTCTGTTGGTCCCTATGTCCCTCTGTGGCTTGGA

TGTGAAGCTGGATTTTATGTGGACGCCGGCCCTCCCACCCATGCCTTTAGCCCCTGTGGGCACGTGTGTTCAGAAAAGACAACGGCTTACTGGTCCCAGA

TCCCACTTCCTCATGGTACGCACACTTTTCATGCAGCCTGCCCCTTCTGTGCACATCAGTTGGCTGGTGAACAAGGCTATATCAGACTTATTTTCCAAGG

ACCTTTAGACTAGCAGCTGTCCTCCAGGACTGCATTGTAAGTTTATAAGCTAAGTGATTGGGTTTGCTAACCGACCCCTTGTCCATGTAAGTTTCTCTGC

TCTGGTCATTTGCATTAAGATGAAGAATTTTTTAAATATTTATAAGCAATTTCTGAGAAAAATCTGGGAAACTCAAGCAAAGGAATTTTTGAAAGTTCCA

GACTTCTGAACTCTGAGTTTTGAAAATCTATTTTGAGAAAAAAAAGACATAGTTTAATTTGATGCCTTCCTTTGTTTAGTGTTCTTGAATCACCGCCCAC

CCTCAGTGTTGAGAGGTTGTGCTGTAGAACTGAGGGTCTGTTGGTTCAAACTATGTTAGTTTACAATTTGTTGCAGACATTGTAAAATACAGCAACATGT

ATATTAATTTTTCTATTTATCTTTATCATAGAAAGTACCTTAGAATGTTGTGATAGGCTAGCATGGTAATGATGGTGTCACACATTTGGTGTGAGTGGTA

GGGTAGTGAGCACAAGGCTCAAAGGTTTGCAAAGTTAAGGAGAAAGACAGGAGAGCTTCCCCCCCCCCCAGCCCCATAATTAGGGGATATTTCATAAAAC

CAGAATATTTCATAAAACCAGATTCATATTAATTACCATTGTCTAAAAGGTGTTTGTTTTTAACCATATTGACGTTAACCAGAAAATGGTTTTTTTCCTT

AATCTTTCTCTCAAGTGTAGTACTAGAACAAAAGTTAATGCTAAGAAACGTTTTATATGCTCCTTTGAATATGCAATTTAATCTAGATGATCTATTTTTC

TCCCATGATAACTGATCTGTTTTTAGTGCCAGCAACATTTGGCAAGTTTATTTTTTTGGATATAAACTGTGGTTCATCTGTTCACTGTTTCTAAAAAAAA

AAAGAAAAAAAAGAAAAAAGAAAAGAAAAAAGAAAAAAATCCTATGAGAAAGTGAAGAAATTAACAAGAAAATTACTTGATTTGCTCTAGAAAAATTAAA

TAAAAAGTGTTTTGTTAATTATTCTGTATTTGGATTATTCCAGGCATTAGAACATCTAGAGCTGTAAAGGGTTGGCTGCAATGGTACCTCCCTTTGTAGC

CCAGCAGACCAGCCTTAACTGTGGGCTTGACTCCTCAGGAGCTGGCCTCAGTGTGACTCATGGAAATGTTTGCTTAGCGGATGAAAGTGAGGACACACCG

CAGGGGCTGCTGTTCTCTTCCTCCATATGTGCTGTGCAGGACAGTTTCTTCTCACCGTAGCCTTTTTAAATGCACCAGAAGTACAGACAGTTGCACTACA

CCAAACCCTTTCAACACTTGTAGAAATCAGCACACTGTAGATTAGACGGAATCATCTTTCAGTCCTTTGACTTCTTTTCCTTAAGTTTGAAAAATTGTAT

AATAATTGACTACTGTCAAATTTTTGTATGTGGTAGTATAGCTTTAATTTATCTTACTACATTAACGTTTTGATTTTAAAAAATTAAAACAAAAAAAGTC

ACTTAGAAGCCATGAACTATTTTATTTTATTGTCAATTTTTCTTGTTTTGAAAATTATCATTTGGGTTCACTCAGGAAATGCATGTCAAGATCTGTATTA

TAAGTTATCTGTGATGTATCAGTAGCTGCTGGTTATTACCCTTTTTTCAAGGAAATTTCGTTGATTTGAAGTTTTCTGGTTACAAACTTTGTGACCAATG

CAAGGAAACCAAGTCCTGTGTTGTGTTTTGTCATTTCTGTTGAGGCTCTATATTGTAGCTTAATTTTTATTTGCAATTAATTTATTCAAACTAAGTAAAT

ACTTTTCAAAATAGCT
Translation
 - UNI22384 - MFSPDQENHPSKAPVKYGELIVLG GYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAK - UNI24125 - AIS

NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQ IGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERSPPFTARIYAAGFDSSKNIFLG E

KAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKM VEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKH

LEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPC

GHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

For any suggestions or comments, please send an email to unitrap@crg.es