Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020143 (Dock2)
Chromosomal location
Chr 11: 34126864 - 34597394 (-)
Description
dedicator of cyto-kinesis 2 Gene [Source:MGI (curated);Acc:Dock2-001]
RefSeq_peptide
NP_203538.2 
UniGene
Mm.432172 Mm.380679 
MGI
MGI:2149010 
Uniprot/SWISSPROT
Q8C3J5 
Uniprot/SPTREMBL
Q3TMS1 Q5SRI3 Q5SRI4 Q6A0A3 
Human Ortholog
ENSG00000134516 (DOCK2)
Omim not available
UniTrap UNI37616
Vector Insertion
Chr 11: 34546932 - 34569785
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26886
Vector Insertion
Chr 11: 34545089 - 34545842
Public Clones not available
Private Clones OST88198 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27703
Vector Insertion
Chr 11: 34414537 - 34501009
Public Clones not available
Private Clones OST52586 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20705
Vector Insertion
Chr 11: 34403415 - 34414427
Public Clones not available
Private Clones OST354142 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19963
Vector Insertion
Chr 11: 34401277 - 34403343
Public Clones not available
Private Clones OST376265 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37583
Vector Insertion
Chr 11: 34338274 - 34364959
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22940
Vector Insertion
Chr 11: 34194360 - 34200486
Public Clones not available
Private Clones OST280698 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101364
Sequence
ATGGCCCCCTGGCGCAAAACTGACAAGGAGCGTCACGGAGTGG CTATCTACAACTTCCAAGGCAGTGAAGCCCAGCATCTCACGCTACAGATTGGCGAT

GTGGTACGAATACAGGAGACCTGTGGAG ACTGGTACAGAGGGTACCTCATAAAGCATAAACTGTCACAG GGCATTTTCCCTACATCCTTTATCCATCT

CAAGGAAGTGACAGTGGAGAAGAGAAG - UNI26886 - GAACATAGAGAACATCATTCCTGCAGAAATCCCTCTGGCACAAGAAGTGACAACCACGC

TCTGGGAGTGGGGAAGCATCTGGAAGCAGCTCTATGTG GCCAGCAAAAAGGAACGCTTCCTCCAAGTGCAGTCCATGATGTACGACCTGATGGAATGGC

GCTCTCAGCTCCTCTCAGGAACGCTACCCAAGGATGAGCTGAAGGAACTGAAGCAGAAAGTCACATCGAAGATCGACTATGGCAACAA AATCCTTGAGC

TCGATCTCATTGTCAGAGATGAAGATGGAAACATACTGGACCCTGATAAGACCAGCGTCATCAGCTTGTTCCATGCTCACGAGGAGGCAACTTACAAAAT

CACAGAGCGCATCAAAGAAGAAATG TCAAAAGACCAGCCAGATTATGGGGTTTATTCTCGGATCTCCTCATCCCCCACCCACAGCCTCTACGTCTTTGT

GAGAAACTTTGTGTGCCGAATTGGGGAGGATGCTGAGCTCTTCATGTCTCTCTATGACCCTCACAAGCAAACGGTCATCAG TGAGAACTATCTGGTGCG

ATGGGGCAGCAAAGGATTCCCAAAGGAAATTGAGATGCTCAATAACCTGAAGGTAGTCTTCACG GATCTTGGAAATAAAGACCTCAACAGGGATAAGAT

TTTCTTGATCTGTCAAATAGTCCGAATTGGGAAGATGGATCTTAAGGACATTAATGCCAAGAAGTGCACCCAGGGGCTGAGGAGACCTTTTGGGGTGGCA

G TTATGGACATCACCGACATCATCAAGGGCAAGGCAGAGAGCGACGAAGAGAAGCAACATTTTATTCCATTTCACCC GGTCTCAGCTGAGAACGATTT

CCTTCACAGCCTTCTGGGCAAAGTCATAGCTTCCAAGGGAGACAGTGGAGGGCAAG GCCTTTGGGTGACCATGAAGATGCTGGTGGGGGACATCATTCA

GATCCGTAAAGACTACCCACACTTGGTGGACAGGACCACTGTGGTAGCCCGAAAGCTGGGCTTCCCAGAGATCATCATGCCAG GGGATGTCAGGAACGA

CATCTACATCACTCTCTTACAAGGTGACTTTGACAAGTACACCAAGACCACACAGCGGAACGTGGAAGTGATCATGTGTGTGTGCACAGAGGATGGCAAA

GTGCTACCT AATGCAATTTGTGTGGGAGCGGGGGATAAGGCCATGAACGAGTACCACTCAGTCGTCTACTACCAAGTCAAACAGCCCCGATGGATGGAA

ACAGTCAAG GTGGCTGTCCCTATTGAAGATATGCAGAGGATCCATTTGAGGTTCATGTTTCGACACCGCTCATCACTAGAAT CTAAAGATAAAGGAGA

AAAGAACTTTGCCATGTCCTACGTGAAACTCATGAAAGAAGATGGAACCACTCTGCATGATGGATACCACGAGTTGGTGGTTCTCAAG GGAGACAGCAA

GAAAATGGAAGATGCCAGCGCTTACCTGACACTTCCTTCTTATCGACACCCCGTGGAAAACAAGGGAGCTACGCTGAGCCGGAGCTCCAGCAGTGTTGGG

GGCCTTTCTGTCAGCTCCCGGGATGTGTTCTCCATTTCCACGCTAGTGTGCTCCACAAAGCTGACCCAGAATG TGGGTTTGCTTGGCTTGCTGAAGTGG

CGTATGAAGCCACAACTGCTCCAGGAGAATCTAGAGAAGTTGAAGATTGTGGATGGCGAGGAAGTAGTGAAG TTCCTCCAGGACACTCTGGATGCCCTC

TTCAACATCATGATGGAACACTCTCAGAGTAACGAGTATGACATCCTCGTCTTTGATGCTTTG ATCTATATAATAGGACTCATTGCAGACCGGAAATTC

CAGCATTTTAACACCGTATTGGAGGCTTACATCCAACAGCATTTCAGTGCTACCTTGGCCTACAA GAAACTGATGACGGTGCTGAAGACTTACTTGGAT

ACCTCCAGCAGGGGGGAGCAGTGCGAGCCCATCCTCAGAACGCTCAAAGCCTTAGAATACGTGTTCAAGTTCATTGTTCGGTCGAGGACATTATTCTCAC

A - UNI27703 - GCTTTACGAAGGCAAAGAGCAGATGGAGTTTGAAGAATCCATGAGACGGCTCTTCGAATCCATCAACAACCTGATGAAAAGTCAG

TACAAGACCACCATCCTATTGCAG - UNI20705 - GTGGCGGCTTTGAAATACATCCCTTCAGTCCTTCACGATGTGGAAACAGTCTTTGATGCCAA

GTTGCTCAG - UNI19963 - CCAGCTACTGTATGAGTTCTACACCTGCATCCCTCCCGTGAAGCTGCAGAAGCAGAAAGTTCAGTCCATGAATGAGA

TCGTGCAGAGCAACCTCTTCAAAAAGCAAG AATGCCGGGACATTCTGCTTCCTGTCATCACCAAAGAGCTGAAGGAGCTGCTGGAGCAGAGGGACGATG

GGCAGCACCAGGCTGAGAAGAAGCACTGTGTGGAACTTCTCAACAGCATCTTGGAGGTCCTCAGCTGTCAGGATGCG GCCTTCACTTATGACCACATCC

AAGAGATCATGGTCCAGCTGCTTCGCACAGTGAACCGGACAGTCATCACGATGGGCCGAGATCACGCTTTGATT GTAAGGTCTAAAGGTGCTCATAGCA

AGGAGGGAACACTAGACCTTCCAGCTGGTG TTGTTCTCTGTCTCTCTCCCCCCACCTCTCTCTCTGACCGGCAAAGTGAAGCCAAAGGACCTAAGACCA

GGAGTGACTTCAACTCCAAACCCACAACCAACATAAGGAAGCCACTCAGCTCACTGATTCTGTCCTGTCTCAGGCAGAGCAGTCCCCATAATCTTGCTTA

CTATTGA
Translation
    - UNI26886 -                  MTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQ - UNI27703 - QLYEGKEQM

EFEESMRRLFESINNLMKSQYKTTILLQ - UNI20705 - VAALKYIPSVLHDVETVFDAKLLS - UNI19963 - SQLLYEFYTCIPPVKLQKQK

VQSMNEIVQSNLFKKQE ECRDILLPVITKELKELLEQRDDGQHQAEKKHCVELLNSILEVLSCQDA AFTYDHIQEIMVQLLRTVNRTVITMGRDHALI

 VRSKGAHSKEGTLDLPAGV VVLCLSPPTSLSDRQSEAKGPKTRSDFNSKPTTNIRKPLSSLILSCLRQSSPHNLAYY
Transcript ENSMUST00000101365
Sequence
AAGGCGCCTAACCACCCCAGCCAGCTTCTTCACTAGAGAACAGGAGGCTCTCAAGGCTCCGGTCTTGCCATGGCCCCCTGGCGCAAAACTGACAAGGAGC

GTCACGGAGTGG CTATCTACAACTTCCAAGGCAGTGAAGCCCAGCATCTCACGCTACAGATTGGCGATGTGGTACGAATACAGGAGACCTGTGGAG AC

TGGTACAGAGGGTACCTCATAAAGCATAAACTGTCACAG GGCATTTTCCCTACATCCTTTATCCATCTCAAGGAAGTGACAGTGGAGAAGAGAAG - U

NI26886 - GAACATAGAGAACATCATTCCTGCAGAAATCCCTCTGGCACAAGAAGTGACAACCACGCTCTGGGAGTGGGGAAGCATCTGGAAGCAGCT

CTATGTG GCCAGCAAAAAGGAACGCTTCCTCCAAGTGCAGTCCATGATGTACGACCTGATGGAATGGCGCTCTCAGCTCCTCTCAGGAACGCTACCCAA

GGATGAGCTGAAGGAACTGAAGCAGAAAGTCACATCGAAGATCGACTATGGCAACAA AATCCTTGAGCTCGATCTCATTGTCAGAGATGAAGATGGAAA

CATACTGGACCCTGATAAGACCAGCGTCATCAGCTTGTTCCATGCTCACGAGGAGGCAACTTACAAAATCACAGAGCGCATCAAAGAAGAAATG TCAAA

AGACCAGCCAGATTATGGGGTTTATTCTCGGATCTCCTCATCCCCCACCCACAGCCTCTACGTCTTTGTGAGAAACTTTGTGTGCCGAATTGGGGAGGAT

GCTGAGCTCTTCATGTCTCTCTATGACCCTCACAAGCAAACGGTCATCAG TGAGAACTATCTGGTGCGATGGGGCAGCAAAGGATTCCCAAAGGAAATT

GAGATGCTCAATAACCTGAAGGTAGTCTTCACG GATCTTGGAAATAAAGACCTCAACAGGGATAAGATTTTCTTGATCTGTCAAATAGTCCGAATTGGG

AAGATGGATCTTAAGGACATTAATGCCAAGAAGTGCACCCAGGGGCTGAGGAGACCTTTTGGGGTGGCAG TTATGGACATCACCGACATCATCAAGGGC

AAGGCAGAGAGCGACGAAGAGAAGCAACATTTTATTCCATTTCACCC GGTCTCAGCTGAGAACGATTTCCTTCACAGCCTTCTGGGCAAAGTCATAGCT

TCCAAGGGAGACAGTGGAGGGCAAG GCCTTTGGGTGACCATGAAGATGCTGGTGGGGGACATCATTCAGATCCGTAAAGACTACCCACACTTGGTGGAC

AGGACCACTGTGGTAGCCCGAAAGCTGGGCTTCCCAGAGATCATCATGCCAG GGGATGTCAGGAACGACATCTACATCACTCTCTTACAAGGTGACTTT

GACAAGTACACCAAGACCACACAGCGGAACGTGGAAGTGATCATGTGTGTGTGCACAGAGGATGGCAAAGTGCTACCT AATGCAATTTGTGTGGGAGCG

GGGGATAAGGCCATGAACGAGTACCACTCAGTCGTCTACTACCAAGTCAAACAGCCCCGATGGATGGAAACAGTCAAG GTGGCTGTCCCTATTGAAGAT

ATGCAGAGGATCCATTTGAGGTTCATGTTTCGACACCGCTCATCACTAGAAT CTAAAGATAAAGGAGAAAAGAACTTTGCCATGTCCTACGTGAAACTC

ATGAAAGAAGATGGAACCACTCTGCATGATGGATACCACGAGTTGGTGGTTCTCAAG GGAGACAGCAAGAAAATGGAAGATGCCAGCGCTTACCTGACA

CTTCCTTCTTATCGACACCCCGTGGAAAACAAGGGAGCTACGCTGAGCCGGAGCTCCAGCAGTGTTGGGGGCCTTTCTGTCAGCTCCCGGGATGTGTTCT

CCATTTCCACGCTAGTGTGCTCCACAAAGCTGACCCAGAATG TGGGTTTGCTTGGCTTGCTGAAGTGGCGTATGAAGCCACAACTGCTCCAGGAGAATC

TAGAGAAGTTGAAGATTGTGGATGGCGAGGAAGTAGTGAAG TTCCTCCAGGACACTCTGGATGCCCTCTTCAACATCATGATGGAACACTCTCAGAGTA

ACGAGTATGACATCCTCGTCTTTGATGCTTTG ATCTATATAATAGGACTCATTGCAGACCGGAAATTCCAGCATTTTAACACCGTATTGGAGGCTTACA

TCCAACAGCATTTCAGTGCTACCTTGGCCTACAA GAAACTGATGACGGTGCTGAAGACTTACTTGGATACCTCCAGCAGGGGGGAGCAGTGCGAGCCCA

TCCTCAGAACGCTCAAAGCCTTAGAATACGTGTTCAAGTTCATTGTTCGGTCGAGGACATTATTCTCACA - UNI27703 - GCTTTACGAAGGCAAA

GAGCAGATGGAGTTTGAAGAATCCATGAGACGGCTCTTCGAATCCATCAACAACCTGATGAAAAGTCAGTACAAGACCACCATCCTATTGCAG - UNI2

0705 - GTGGCGGCTTTGAAATACATCCCTTCAGTCCTTCACGATGTGGAAACAGTCTTTGATGCCAAGTTGCTCAG - UNI19963 - CCAGCTAC

TGTATGAGTTCTACACCTGCATCCCTCCCGTGAAGCTGCAGAAGCAGAAAGTTCAGTCCATGAATGAGATCGTGCAGAGCAACCTCTTCAAAAAGCAAG 

AATGCCGGGACATTCTGCTTCCTGTCATCACCAAAGAGCTGAAGGAGCTGCTGGAGCAGAGGGACGATGGGCAGCACCAGGCTGAGAAGAAGCACTGTGT

GGAACTTCTCAACAGCATCTTGGAGGTCCTCAGCTGTCAGGATGCG GCCTTCACTTATGACCACATCCAAGAGATCATGGTCCAGCTGCTTCGCACAGT

GAACCGGACAGTCATCACGATGGGCCGAGATCACGCTTTGATT AGTCACTTTGTGGCGTGTATGACAGCTATCTTAGACCAGATGGGCGACCAACACTA

TTCATTTTACATTGAGACCTTCCAGACCAGCTCAGACCTTGTG GACTTCTTGATGGAGACATTCATCATGTTCAAGGACCTCATTGGGAAGAATGTGTA

TCCTGGGGACTGGATGGCCATGAGCATGGTCCAGAACCG GGTCTTCCTGAGAGCCATCAACAAGTTTGCAGAAACCATGAACCAGAAGTTTCTGGAACA

CACAAGCTTTGAGTTCCAG - UNI22940 - CTGTGGAACAACTATTTTCATCTGGCAGTTGCCTTTATCACTCAGGACTCTCTGCAGCTGGAGCAGT

TCACACACGCTAAGTACAACAAAATCCTGAATAA GTACGGGGACATGAGACGGCTCATAGGATTCTCCATCCGTGATATGTGGTACAAGCTTG GCCAG

AACAAAATCTGCTTCATCCCGGGCATGGTGGGACCTATATTAGAGATGACACTTATCCCTGAGGCTGAGCTCAGGAAAGCCACCATCCCAATCTTCTTCG

ACATGATGCTGTGTGAATATCAAAGGACTGGGGCTTTCAAAAAG TTTGAAAATGAAATCATCCTGAAGCTGGACCATGAGGTGGAAGGAGGCCGGGGGG

ATGAGCAGTACATGCAACTGCTGGAGTCCAT GTTTACTGTCTTGGGTCATGTTTCACTGGGTGGCCTCCTAAGCTCAGGGAGGCAAGCACATTGACAGA

GCATACAGAGAAGAGCTTCCTTGAAGGAGGTATAAGACCTTCAGTGTGCCCTGCAAGACTTCAGTGCCCAAGTCTGGAGCAGATAGTGCAGAGGAAACAG

CACTCAGCATGACTGGACTTGAAGTCAAGAAATTTTTGTTTTGTTTTCTCAAATGTTAAGATAAATTCATATACGGTTCTGTCT
Translation
MAPWRKTDKERHGVA AIYNFQGSEAQHLTLQIGDVVRIQETCGD DWYRGYLIKHKLSQ GIFPTSFIHLKEVTVEKRR - UNI26886 - RNIENI

IPAEIPLAQEVTTTLWEWGSIWKQLYV ASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNK KILELDLIVRDEDGNILDPDK

TSVISLFHAHEEATYKITERIKEEM SKDQPDYGVYSRISSSPTHSLYVFVRNFVCRIGEDAELFMSLYDPHKQTVIS SENYLVRWGSKGFPKEIEMLN

NLKVVFT DLGNKDLNRDKIFLICQIVRIGKMDLKDINAKKCTQGLRRPFGVAV VMDITDIIKGKAESDEEKQHFIPFHP PVSAENDFLHSLLGKVIA

SKGDSGGQG GLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG GDVRNDIYITLLQGDFDKYTKTTQRNVEVIMCVCTEDGKVLP NAI

CVGAGDKAMNEYHSVVYYQVKQPRWMETVK VAVPIEDMQRIHLRFMFRHRSSLES SKDKGEKNFAMSYVKLMKEDGTTLHDGYHELVVLK GDSKKME

DASAYLTLPSYRHPVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNV VGLLGLLKWRMKPQLLQENLEKLKIVDGEEVVK FLQDTLDALF

NIMMEHSQSNEYDILVFDAL IYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYK KKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLF

SQ - UNI27703 - QLYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQ - UNI20705 - VAALKYIPSVLHDVETVFDAKLLS - UNI199

63 - SQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQE ECRDILLPVITKELKELLEQRDDGQHQAEKKHCVELLNSILEVLSCQDA AFTYDHI

QEIMVQLLRTVNRTVITMGRDHALI SHFVACMTAILDQMGDQHYSFYIETFQTSSDLV DFLMETFIMFKDLIGKNVYPGDWMAMSMVQNR RVFLRAI

NKFAETMNQKFLEHTSFEFQ - UNI22940 - LWNNYFHLAVAFITQDSLQLEQFTHAKYNKILNK KYGDMRRLIGFSIRDMWYKLG GQNKICFIP

GMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRTGAFKK FENEIILKLDHEVEGGRGDEQYMQLLESM MFTVLGHVSLGGLLSSGRQAH
Transcript ENSMUST00000093193
Sequence
ATGGCCCCCTGGCGCAAAACTGACAAGGAGCGTCACGGAGTGG CTATCTACAACTTCCAAGGCAGTGAAGCCCAGCATCTCACGCTACAGATTGGCGAT

GTGGTACGAATACAGGAGACCTGTGGAG ACTGGTACAGAGGGTACCTCATAAAGCATAAACTGTCACAG GGCATTTTCCCTACATCCTTTATCCATCT

CAAGGAAGTGACAGTGGAGAAGAGAAG - UNI26886 - GAACATAGAGAACATCATTCCTGCAGAAATCCCTCTGGCACAAGAAGTGACAACCACGC

TCTGGGAGTGGGGAAGCATCTGGAAGCAGCTCTATGTG GCCAGCAAAAAGGAACGCTTCCTCCAAGTGCAGTCCATGATGTACGACCTGATGGAATGGC

GCTCTCAGCTCCTCTCAGGAACGCTACCCAAGGATGAGCTGAAGGAACTGAAGCAGAAAGTCACATCGAAGATCGACTATGGCAACAA AATCCTTGAGC

TCGATCTCATTGTCAGAGATGAAGATGGAAACATACTGGACCCTGATAAGACCAGCGTCATCAGCTTGTTCCATGCTCACGAGGAGGCAACTTACAAAAT

CACAGAGCGCATCAAAGAAGAAATG TCAAAAGACCAGCCAGATTATGGGGTTTATTCTCGGATCTCCTCATCCCCCACCCACAGCCTCTACGTCTTTGT

GAGAAACTTTGTGTGCCGAATTGGGGAGGATGCTGAGCTCTTCATGTCTCTCTATGACCCTCACAAGCAAACGGTCATCAG TGAGAACTATCTGGTGCG

ATGGGGCAGCAAAGGATTCCCAAAGGAAATTGAGATGCTCAATAACCTGAAGGTAGTCTTCACG GATCTTGGAAATAAAGACCTCAACAGGGATAAGAT

TTTCTTGATCTGTCAAATAGTCCGAATTGGGAAGATGGATCTTAAGGACATTAATGCCAAGAAGTGCACCCAGGGGCTGAGGAGACCTTTTGGGGTGGCA

G TTATGGACATCACCGACATCATCAAGGGCAAGGCAGAGAGCGACGAAGAGAAGCAACATTTTATTCCATTTCACCC GGTCTCAGCTGAGAACGATTT

CCTTCACAGCCTTCTGGGCAAAGTCATAGCTTCCAAGGGAGACAGTGGAGGGCAAG GCCTTTGGGTGACCATGAAGATGCTGGTGGGGGACATCATTCA

GATCCGTAAAGACTACCCACACTTGGTGGACAGGACCACTGTGGTAGCCCGAAAGCTGGGCTTCCCAGAGATCATCATGCCAG GGGATGTCAGGAACGA

CATCTACATCACTCTCTTACAAGGTGACTTTGACAAGTACACCAAGACCACACAGCGGAACGTGGAAGTGATCATGTGTGTGTGCACAGAGGATGGCAAA

GTGCTACCT AATGCAATTTGTGTGGGAGCGGGGGATAAGGCCATGAACGAGTACCACTCAGTCGTCTACTACCAAGTCAAACAGCCCCGATGGATGGAA

ACAGTCAAG GTGGCTGTCCCTATTGAAGATATGCAGAGGATCCATTTGAGGTTCATGTTTCGACACCGCTCATCACTAGAAT CTAAAGATAAAGGAGA

AAAGAACTTTGCCATGTCCTACGTGAAACTCATGAAAGAAGATGGAACCACTCTGCATGATGGATACCACGAGTTGGTGGTTCTCAAG GGAGACAGCAA

GAAAATGGAAGATGCCAGCGCTTACCTGACACTTCCTTCTTATCGACACCCCGTGGAAAACAAGGGAGCTACGCTGAGCCGGAGCTCCAGCAGTGTTGGG

GGCCTTTCTGTCAGCTCCCGGGATGTGTTCTCCATTTCCACGCTAGTGTGCTCCACAAAGCTGACCCAGAATG TGGGTTTGCTTGGCTTGCTGAAGTGG

CGTATGAAGCCACAACTGCTCCAGGAGAATCTAGAGAAGTTGAAGATTGTGGATGGCGAGGAAGTAGTGAAG TTCCTCCAGGACACTCTGGATGCCCTC

TTCAACATCATGATGGAACACTCTCAGAGTAACGAGTATGACATCCTCGTCTTTGATGCTTTG ATCTATATAATAGGACTCATTGCAGACCGGAAATTC

CAGCATTTTAACACCGTATTGGAGGCTTACATCCAACAGCATTTCAGTGCTACCTTGGCCTACAA GAAACTGATGACGGTGCTGAAGACTTACTTGGAT

ACCTCCAGCAGGGGGGAGCAGTGCGAGCCCATCCTCAGAACGCTCAAAGCCTTAGAATACGTGTTCAAGTTCATTGTTCGGTCGAGGACATTATTCTCAC

A - UNI27703 - GCTTTACGAAGGCAAAGAGCAGATGGAGTTTGAAGAATCCATGAGACGGCTCTTCGAATCCATCAACAACCTGATGAAAAGTCAG

TACAAGACCACCATCCTATTGCAG - UNI20705 - GTGGCGGCTTTGAAATACATCCCTTCAGTCCTTCACGATGTGGAAACAGTCTTTGATGCCAA

GTTGCTCAG - UNI19963 - CCAGCTACTGTATGAGTTCTACACCTGCATCCCTCCCGTGAAGCTGCAGAAGCAGAAAGTTCAGTCCATGAATGAGA

TCGTGCAGAGCAACCTCTTCAAAAAGCAAG AATGCCGGGACATTCTGCTTCCTGTCATCACCAAAGAGCTGAAGGAGCTGCTGGAGCAGAGGGACGATG

GGCAGCACCAGGCTGAGAAGAAGCACTGTGTGGAACTTCTCAACAGCATCTTGGAGGTCCTCAGCTGTCAGGATGCG GCCTTCACTTATGACCACATCC

AAGAGATCATGGTCCAGCTGCTTCGCACAGTGAACCGGACAGTCATCACGATGGGCCGAGATCACGCTTTGATT AGTCACTTTGTGGCGTGTATGACAG

CTATCTTAGACCAGATGGGCGACCAACACTATTCATTTTACATTGAGACCTTCCAGACCAGCTCAGACCTTGTG GACTTCTTGATGGAGACATTCATCA

TGTTCAAGGACCTCATTGGGAAGAATGTGTATCCTGGGGACTGGATGGCCATGAGCATGGTCCAGAACCG GGTCTTCCTGAGAGCCATCAACAAGTTTG

CAGAAACCATGAACCAGAAGTTTCTGGAACACACAAGCTTTGAGTTCCAG - UNI22940 - CTGTGGAACAACTATTTTCATCTGGCAGTTGCCTTT

ATCACTCAGGACTCTCTGCAGCTGGAGCAGTTCACACACGCTAAGTACAACAAAATCCTGAATAA GTACGGGGACATGAGACGGCTCATAGGATTCTCC

ATCCGTGATATGTGGTACAAGCTTG GCCAGAACAAAATCTGCTTCATCCCGGGCATGGTGGGACCTATATTAGAGATGACACTTATCCCTGAGGCTGAG

CTCAGGAAAGCCACCATCCCAATCTTCTTCGACATGATGCTGTGTGAATATCAAAGGACTGGGGCTTTCAAAAAG TTTGAAAATGAAATCATCCTGAAG

CTGGACCATGAGGTGGAAGGAGGCCGGGGGGATGAGCAGTACATGCAACTGCTGGAGTCCAT CCTGATGGAGTGCACAGCGGAACACCCAACCATTGCC

AAGTCGGTGGAGAACTTTGTGAGCTTGGTCAAAGGGCTGCTGGAGAAGTTGCTAGATTACCGGGGCGTGATGACAGATGAGAGCAAAGACAACCGTATGA

GCTGCACAGTGAACTTGCTG AATTTCTACAAAGATAACAACCGGGAAGAGATGTACATAAG ATACCTGTATAAACTGCGTGACCTTCACTTGGACTGT

GAAAACTACACAGAGGCTGCCTACACACTCCTCCTCCACACCTGGCTTCTCAAG TGGTCAGATGAGCAGTGTGCATCCCAGGTCATGCAGACAGGCCAG

CAGCACCCTCAGACCCACCGGCAGCTGAAGGAGACACTCTATGAGACCATTATAGGCTACTTTGACAAAGGAAAG ATGTGGGAAGAGGCCATCAGCCTG

TGCAAGGAACTGGCGGAACAATATGAGATGGAGATCTTTGACTACGAGCTACTCAGCCAGAACCTG ACCCAGCAGGCCAAATTCTATGAAAACATCATG

AAAATCCTCAGAACCAAACCAGACTACTTTGCTGTTGGATACTATGGCCAGGGATTCCCCTCCTTTCTGCGG AACAAAGTGTTCATCTACCGAGGCAAG

GAATATGAGCGAAGAGAAGACTTCCAGATGCAGCTTTTGAGCCAGTTCCCCAACGCAGAAAAGATGAACACAACTTCTGCCCCAGGAGACGATGTGAGGA

ATGCCCCAGGCCAGT ACATCCAGTGTTTCACTGTGCAGCCTGTTCTGGATGAACACCCCAGGTTCAAGAACAAACCGGTGCCTGACCAGATCATAAA C

TTTTACAAGTCTAATTATGTGCAAAAGTTCCACTACTCCAGGCCTGTGCGCAGGGGCAAGGTAGACCCAGAGAACGAGTTTGCT TCCATGTGGATCGAG

AGGACTTCCTTCCTGACGGCCTACAAGCTGCCTGGCATCCTGCGCTGGTTTGAGGTAGTTCACATGTCTCAG ACCACAATTAGTCCTCTGGAGAATGCC

ATCGAGACTATGTCCACAGTCAACGAGAAGATCCTGATGATGATAAACCAGTACCAGAGTGATGAAAGCCTCCCCATCAACCCTCTCTCCATGCTCCTCA

ATGGGATCGTGGACCCTGCTGTCATGGGAGGCTTCGCCAAGTATGAGAAG GCCTTCTTCACTGAAGAGTATAGCAGGGAGCACCCGGAGGACCAGGACA

AGCTGAGCCATCTCAAGGACCTGATTGCATGGCAG ATCCCTTTCCTGGGAGCTGGGATTAAGATCCACGAGAAAAGGGTGTCAGACAACCTGCGCCCCT

TCCATGACCGGATGGAGGAGTGCTTCAAGAACCTGAAAATGAAGGTGGAAAAGGAGTATGGTGTCCGAGAGATG CCTGACTTCGAAGACAGGAGAGTGG

GCCGCCCCAGGTCCATGCTGCGTTCCTACAGGCAGATGTCCGTCATCTCTCTGGCCTCCATGCATTCTGACTGCAGCACTCCCAGCAAAGTCCCCGCAGA

AAG TTTTGACCTAGAGTCAGCCCCACCCAAGACTCCCAAAGTGGAGGAGGAGCCCATCTCCCCAGGGAGCACTCTGCCAGAGGTCAAGCTGCGGCGGTC

CAAGAAAAGGACCAAGAGGAGCAGCGTGGTGTTTGCAGACGAGAAGGCAGCAACGGAGTCAGACCTGAAGCGG CTTTCTAGAAAGCAAGAGTTCATGAG

TGACACCAACCTCTCAGAGCATGCAGCCATCCCTGCCAGGGTGTCTATCCTCTCTCAGATGAGTTTTGCCAGCCAGTCCATGCCCACCATCCCAG CCCT

CACACTCTCCGTGGCAGGCGTGCCTGGGTTGGATGAGGCCAACACATCTCCCCGCCTGAGTCAGACCTTCTTCCAAGTCTCAGATGGTGACAAGAAGACC

CTGAAAAAGAAGAAAGTCAATCAATTCTTCAAGACCATG CTGGCTAGCAAGTCGAGTGAAGAAAGCAAGCAGATCCCAGACTTCCTGTCCACCAACATG

TGAGGCACTGCTGAGCCGAGCACTGTGGGAACTCGAGCGGGAATGCATGAGTATGACCTTGGAGTTCCACAAGGAGACAAGTCTGTAAAAGAGACAGATG

ATCTCAAGGGGCCCCCAGAACTCAAGTGATGACTAGCCTTGCATCTCCTGTGGCCACTACAACAGTGATGGATGACTCAACAGACAAAGAAGCCCCACCA

TGGATTGTTGGACCCCAAGGAGCCAGCAAGTGCCCAATGAATGTTCTCCCCAGCATCCAAGGGACGCATGTCATAACTCAAATTCACAGCTAGGAGGAGC

TGTCTTCTGTTTCATTCCTAAGTGTCAGCACTTAAAAGAACTGATTTAAATGTTCTATTTTCCCTTAACATTTTTGTACTTTTACATTTTTTTTCTAATA

AGCCCCTTGCTACTCCATCATCTCCAGACTGCTGCTCTTTCTTACCCACATTAAAAATGACCCATAGCTCAAATGAACCTTGTTGCTGAGTCTCTTATTG

AAGGACTGAGGAGAAAGATCCCAGGATGGGAGGCAGCCCAGGGGACTACAGCAATATGAAAGGCTTATGTTGGCTCATCTCAATGCCATGTTTTCTCTCC

TTGCTCAGGCAAACTCAAGAATCTTCTCTGCTCTAAGAAAGAAGCAGGAATGAGATTTCTTCTAATTTCTCCATTGTTTAGTTATTTTGATTTGAGATAC

TTTACTGATATACAAGCTATTTAAACTATTTGGGGAAAAAAGCAATGTTTGAGATAGCTAATATAATGGCTTCTCAATGGAATGATAGCACAATTTGAAA

TGATACC
Translation
MAPWRKTDKERHGVA AIYNFQGSEAQHLTLQIGDVVRIQETCGD DWYRGYLIKHKLSQ GIFPTSFIHLKEVTVEKRR - UNI26886 - RNIENI

IPAEIPLAQEVTTTLWEWGSIWKQLYV ASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNK KILELDLIVRDEDGNILDPDK

TSVISLFHAHEEATYKITERIKEEM SKDQPDYGVYSRISSSPTHSLYVFVRNFVCRIGEDAELFMSLYDPHKQTVIS SENYLVRWGSKGFPKEIEMLN

NLKVVFT DLGNKDLNRDKIFLICQIVRIGKMDLKDINAKKCTQGLRRPFGVAV VMDITDIIKGKAESDEEKQHFIPFHP PVSAENDFLHSLLGKVIA

SKGDSGGQG GLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG GDVRNDIYITLLQGDFDKYTKTTQRNVEVIMCVCTEDGKVLP NAI

CVGAGDKAMNEYHSVVYYQVKQPRWMETVK VAVPIEDMQRIHLRFMFRHRSSLES SKDKGEKNFAMSYVKLMKEDGTTLHDGYHELVVLK GDSKKME

DASAYLTLPSYRHPVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNV VGLLGLLKWRMKPQLLQENLEKLKIVDGEEVVK FLQDTLDALF

NIMMEHSQSNEYDILVFDAL IYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYK KKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLF

SQ - UNI27703 - QLYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQ - UNI20705 - VAALKYIPSVLHDVETVFDAKLLS - UNI199

63 - SQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQE ECRDILLPVITKELKELLEQRDDGQHQAEKKHCVELLNSILEVLSCQDA AFTYDHI

QEIMVQLLRTVNRTVITMGRDHALI SHFVACMTAILDQMGDQHYSFYIETFQTSSDLV DFLMETFIMFKDLIGKNVYPGDWMAMSMVQNR RVFLRAI

NKFAETMNQKFLEHTSFEFQ - UNI22940 - LWNNYFHLAVAFITQDSLQLEQFTHAKYNKILNK KYGDMRRLIGFSIRDMWYKLG GQNKICFIP

GMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRTGAFKK FENEIILKLDHEVEGGRGDEQYMQLLESI ILMECTAEHPTIAKSVENFVSLVKGLLE

KLLDYRGVMTDESKDNRMSCTVNLL NFYKDNNREEMYIR RYLYKLRDLHLDCENYTEAAYTLLLHTWLLK WSDEQCASQVMQTGQQHPQTHRQLKET

LYETIIGYFDKGK MWEEAISLCKELAEQYEMEIFDYELLSQNL TQQAKFYENIMKILRTKPDYFAVGYYGQGFPSFLR NKVFIYRGKEYERREDFQM

QLLSQFPNAEKMNTTSAPGDDVRNAPGQY YIQCFTVQPVLDEHPRFKNKPVPDQIIN NFYKSNYVQKFHYSRPVRRGKVDPENEFA SMWIERTSFLT

AYKLPGILRWFEVVHMSQ TTISPLENAIETMSTVNEKILMMINQYQSDESLPINPLSMLLNGIVDPAVMGGFAKYEK AFFTEEYSREHPEDQDKLSHL

KDLIAWQ IPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM PDFEDRRVGRPRSMLRSYRQMSVISLASMHSDCSTPSKVPAES S

FDLESAPPKTPKVEEEPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAATESDLKR LSRKQEFMSDTNLSEHAAIPARVSILSQMSFASQSMPTIPA A

LTLSVAGVPGLDEANTSPRLSQTFFQVSDGDKKTLKKKKVNQFFKTM LASKSSEESKQIPDFLSTNM

For any suggestions or comments, please send an email to unitrap@crg.es