Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020159 (Gabrp)
Chromosomal location
Chr 11: 33450781 - 33478957 (-)
Description
gamma-aminobutyric acid (GABA-A) receptor, pi Gene [Source:MGI (curated);Acc:Gabrp-001]
RefSeq_dna
NM_146017 
RefSeq_peptide
NP_666129.1 
UniGene
Mm.99989 Mm.403405 Mm.419931 
MGI
MGI:2387597 
Uniprot/SWISSPROT
Q8QZW7 
Uniprot/SPTREMBL
A8Y5I7 Q8K367 
Human Ortholog
ENSG00000094755 (GABRP)
Omim not available
UniTrap UNI13980
Vector Insertion
Chr 11: 33452843 - 33454293
Public Clones CMHD-GT_180G11-3 (cmhd) IST14981H5 (tigm) IST12313A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020366
Sequence
GAGAGAGCGCGCCACTCCATCGGAGACTGGGTGCATACTTAACACCCAAAGAGTCAGGACTGAGATGAAAAGGACCCTGGAGACCCAAAAGAGTATGCTC

TGTGTGAGAGTCCTGCCTGAGATCTGGAAACACCTGCTGTAACAGCTGCCTG GTGATTCCTCCTTCAACCTTTTTGTGTGTGAATCAGCTCCTTCAACA

TGAGCTACAGCCTCTATTTGGCCTTCCTGTGTCTGAGTCTCCTCACTCAGAG GACGTGCATCCAGGGGAACCAGGTCAATGTGGAGGTCAGCAGAAGTG

ACAAGCTTTCCTTACCTGGCTTTGAGAACCTCACTGCAGGATATAACAAATTCCTCAGGCCCAATTTCGGTG GTGACCCAGTTCGGATAGCACTGACTC

TGGACATCGCCAGCATCTCTAGCATCTCAGAGAGTAACATG GACTACACAGCCACTATATACCTCCGGCAGCGTTGGACAGACCCACGGCTAGTGTTCG

AAGGCAACAAGAGCTTTACTCTAGATGCCCGCCTTGTGGAGTTCCTCTGGGTGCCAGACACTTACATTGTAGAGTCCAAGAAGTCCTTCCTCCATGAAGT

CACAGTGGGAAACAGGCTCATCCGCCTCTTCTCCAACGGCACAGTCCTGTACGCACTTAG AATCACAACAACAGTTACATGTAACATGGATCTGTCTAA

ATACCCCATGGACACACAGACCTGCAAGCTGCAGCTAGAAAGTT GGGGATACGATGGCAATGATGTGGAGTTCTCCTGGCTGAGAGGGAATGACTCGGT

GCGTGGACTTGAAAACCTGCGCCTTGCTCAGTACACAATCCAACAGTATTTCACCCTGGTCACCGTATCCCAGCAGGAGACAG GAAACTATACGAGATT

GGTTTTGCAATTTGAGCTTCGGAGGAACGTCCTGTATTTCATTCTGGAAACCTATGTCCCTTCCACCTTCCTGGTGGTGTTATCCTGGGTCTCCTTTTGG

ATCTCCCTCGATTCAGTTCCTGCGAGAACCTGCATTG GAGTGACAACGGTGTTATCCATGACAACGCTGATGATCGGCTCCCGCACATCCCTACCCAAC

ACCAACTGCTTCATAAAGGCCATCGATGTGTACCTAGGCATCTGCTTCAGCTTCGTGTTTGGGGCCTTACTGGAGTATGCAGTTGCTCACTACAGCTCCT

TACAGCAGATGGCAGTCAAAGATAGG - UNI13980 - GGGCCAGCGAAGGACTCGGAAGAAGTCAATATCACCAACATCATCAACAGCTCCATCTCC

AGCTTTAAACGGAAGATTAGCTTTGCCAGCATTGAAATCTCTGGTGACAATGTCAACTATAGTGACTTGACAATGAAAGCCAGCGACAAGTTTAAGTTTG

TCTTCCGAGAGAAGATCAGCAGAATCATTGATTATTTCACAATTCAAAACCCCAGCAATGTGGATCGATACTCCAAACTACTATTTCCTTTGATTTTTAT

GTTGGCCAATGTATTTTACTGGGCATACTACATGTATTTTTGAGACGCCATTGAACTCTTGCATCACATAATGAGGTTAAGGGTATTCTAGAACATGTGT

GTGCACTTCAGCTTAGAAAGCTACAAATGGGCTAATGTAACAATTATTCTAAGTTGTGTAGAAGCCCTAGTGTGACCAGATTCTATAATAGAGTCATTAT

AAGGCAACCCTTTTCTTCTTCAATTTTGGACAGAACACCCCCTCCACACACATACACAGAACCCAAGACTGCGAACCTACTCAGGGCTATTTGCTCTCTG

GATCCCTGGTCTGCATTCACTCCATAAAAATGTGGGAAGATGATTACATATATTAAGGGGTTTATTTTCTAAAGAATTCATAGTGCCACTGATTACATCT

CTGTGGCCCTTATAATATGCTCTCTTGCCTATTTAAACACCAGTGTTTTCTAATTTTTGTTTTTCCTTGAAATATGAAATGTGGGTTTGCGTCAATTCAT

TGGTGGTTACCTTGCCTCATCAACCTAATACCAGATGGGTTCTTAGTGTTATTTAATACCACAGAAGAATTGTCCCCAAATTCTAATACATCCTATTATT

CACAAATCAGATGTAAATGAATAAAATTAGTGGATCAATAAACTAAAAGAAAAAAACATAAATCCTTTGGGGTCCAGGGCTTCATGCCGTTTTTCCACGT

ATCTTATTATTTTGTTTTTATACACCTTAGTCCTAACCTATGTAAAAACCCCTTTTCCACATCAGGAAAACGGGAGGAAGTTTTGAAACTTGTTCTGGAT

TCCTAATACAGAATGCGTCCATGAAGACTTGCTGAGTCAAGTGTACTAGCTAGCCACCTTTACTCACATACTGGCTAGGAACCAAGTAGACCAGAGAGTG

CTCTGTCAACCTGTCCTCTCTGCTGACCTGTTGACCAAGATGCTGGGGAACATTTTGCCGGTGGCAAAGGCCCTGCCTCCTTCAAAGAGGAGCTTTTATC

CCTGTGCTCCAGTGACTAGGCAGGAGTGATGTCTATTAGATAAGAAGCGGCACTACTGGGACACAAGTAGCTTATCTTAAATAGTTACCTTTTCCCAACC

TTTCTAGCTGGACTACTTTGAGTGGATTACCCTGCCTGAGCAGCAGACCACTGGCCCTGACTGGTTCCGACTGTTCTGAACGATGGAAAGACACATTGCA

CAACCCACGTGAGCTGTCTTTTCTGAGTTCAGCCAGGGTCACCCTGACCTAGGAGCTCTTGTGTGCCCTCTCTCTCTCTTGCTCCACGGGAATCGCCTAT

ATAAGGTTCCAATGCAGCCTCAATTGTTTCAAAGACTCTTGCTGTCTTCAGGTCTTTCCCTTCCTTTTCTAATGAACCCTCAGCTTTCCCTGTCCTTTCT

ACAACAAACCGGGGCTGTAGATGTTCTTTCCTTTCACGTCCTTCACCCACGGGCCCTCCTTTTCATCAGCATGGCTCTGCCCATCGTTCCGTTTCTGTGA

GCTTGAGTGCCTGGCGCTTAACAGATGTTTCTATTTTAGGATTCGCTTTGTTCATTGGAGTACAATAGGTGTAGTTGCGCCATTAGAGTTCTTAGTAGAA

TCTCTTTGTATTTTGTATCTGTCATATACATTCCTAAGGGGAGGGGCTAGGGGAGGGGAAGTGTGGTTGAGTGAGTAGGTCATACCTGTGCATTTTTTTT

TAAAAATAAAAATGTTTAAAATATAACTTCACTGAGGCCTCATTTTAAGCTACAGAAAAATAAAAGTTGTAAATATGTGAAACTATAAAATAAATATATA

GT
Translation
 MSYSLYLAFLCLSLLTQR RTCIQGNQVNVEVSRSDKLSLPGFENLTAGYNKFLRPNFGG GDPVRIALTLDIASISSISESNM DYTATIYLRQRWTD

PRLVFEGNKSFTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALR RITTTVTCNMDLSKYPMDTQTCKLQLESW WGYDGNDVEF

SWLRGNDSVRGLENLRLAQYTIQQYFTLVTVSQQETG GNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIG GVTTVLSMT

TLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR - UNI13980 - GPAKDSEEVNITNIINSSISSFKRKISFASIE

ISGDNVNYSDLTMKASDKFKFVFREKISRIIDYFTIQNPSNVDRYSKLLFPLIFMLANVFYWAYYMYF

For any suggestions or comments, please send an email to unitrap@crg.es