Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020160 (Meis1)
Chromosomal location
Chr 11: 18780674 - 18918964 (-)
Description
Meis homeobox 1 Gene [Source:MGI (curated);Acc:Meis1-004]
RefSeq_dna
NM_010789 
RefSeq_peptide
NP_034919.1 
UniGene
Mm.356578 Mm.410048 
MGI
MGI:104717 
Uniprot/SWISSPROT
Q60954 
Uniprot/SPTREMBL
Q3UJ00 
Human Ortholog
ENSG00000143995 (MEIS1)
Omim not available
UniTrap UNI32979
Vector Insertion
Chr 11: 18841661 - 18888383
Public Clones IST12484C1 (tigm) IST10592B9 (tigm) IST15089B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22728
Vector Insertion
Chr 11: 18805769 - 18841661
Public Clones IST11893E3 (tigm)
Private Clones OST286195 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118661
Sequence
AGCTGCACTTAGACTGAAGTATTTTGA GTACACGAATTATGTGACAATTTCTGCCACCGGTATATTAGCTGTTTGAAAGGGAAAATGCCTATCGATTTG

GTGATAGATGATAGAGAAGGAGGATCAAAATCAGACAGTGAAGATGTAACAAGATCAGCAAATCTAACTGACCAG - UNI32979 - CCCTCTTGGAA

TAGAGACCATGATGACACGGCATCCACTCGTTCAGGAGGAACCCCGGGCCCTTCCAGCGGTGGCCATACTTCACACAGTGGGGATAACAGCAGTGAGCAA

G - UNI32979 - GTGATGGCTTGGACAACAGTGTAGCTTCCCCCAGCACAGGTGACGATGATGACCCTGATAAGGACAAAAAGCGTCACAAAAAGCG

TGGCATCTTTCCCAAAGTAGCCACCAATATCATGAGGGCGTGGCTGTTCCAGCATCTAACA - UNI22728 - - UNI32979 - CACCCTTACCCT

TCTGAAGAACAGAAAAAGCAGTTGGCACAAGATACAGGACTTACCATCCTTCAAGTGAACAATTG GTTTATTAATGCCCGGAGAAGAATAGTGCAGCCC

ATGATAGACCAGTCCAACCGAGCAG TCAGCCAAGGGACACCTTATAACCCTGATGGACAGCCAATGGGAGGTTTTGTAATGGACGGTCAGCAGCACATG

GGCATCAGAGCGCCAG GACCTATGAGTGGAATGGGCATGAATATGGGCATGGAGGGGCAGTGGCACTACATGTAACCTTCATCTAGTTAACCAATCGAA

AGCCAGGGGGAA GGCTGCAAAGTATGCCAGGGGAGTATGTAGCCCGGGGTGGCCCAATGGGTGTGAGTATGGGACAGCCGAGTTATACCCAAGCCCAGA

TGCCCCCCCATCCTGCTCAGCTGCGTCATGGGCCCCCCATGCATACGTACATTCCTGGACACCCTCACCACCCCGCAGTGATGATGCATGGAGGACAGCC

CCACCCTGGAATGCCAATGTCAGCCTCAAGCCCCTCGGTTCTTAACACAGGAGACCCGACAATGAGTGCACAAGTCATGGACATTCACGCTCAGTAGCTT

AAGGGAATATGCGTTGTCTACAATGGTGACTGATCTCGAATCAGGTCTTTTCCTGCAAGGACTATGGAGTTCCATTCTTGACATCTACTTTGGACCAAGG

AGCATCCCTAGTTCTTCATAGGGACTCTTAAAATGCAGGAGAACCATCCGAAGTCAACTCGGGGGACATGCAAAAATAACTATATAAGACATTAAAAGAA

CAAAGAGTGAAATATTGTAAATGCTATTATACTGTTATCCATATTACGTTGTTTCTTATAGATTTTTTAAAAAAAATGTGAAATTTTTCCACACTATGTG

TGTTGTTTCCATAGCTGTTCACTTCCTCCAGAAGCCTCCTTACATTAAAAAGCCTTACAGTTATCCTGCAAGGGACAGGAAGGTCTGATTTGCAGGATTT

TTAGAGCATTAAAATAACTATCAGGCAGAAGAATCTTTCTTCTTGCCTAGGATTTCAGCCATGTGCGTGCGCTCTCTCTCTCTCTCTCTCTCTCTCTCTC

TCTCTCTCTCTCTCTCTCTCTCTCTCTCTTCTCCTCCCTCTCCCTCTTTCTAGCCTGGGGCTTGAATTTGCATGTCTAATTCATTTACTCACCATATTTG

AATTGGCCTGAACAGATGTAAATCGGGAAGGATGGGAAAAACTGCAGTCACCAACAATGATTAATCAGCTGTTGCAGGCAGTGTCTTAAGGAGACTGGTA

GGAGGAGGCATGGAAACCCAAAGGCCGTGTGTGTTTAGAAGCCTAACTGTCACATCAAGCATCATCGTCCCCATGCAACAACAACCATCACCTTATACAT

CACTTCCTGTTTTATGCAGCTCAAAAAACATAGACTGAAGATTTATTTTTTAATATGTTGACTTTGTTTCTCAGCAAAGCATTGGTCATGTGTGTATTTT

TCCATAGTCCCACCTTGGAGCATTTATGTAGACATTGTAAATAAATTTTGTGCAAAAAGGACTGG
Translation
 MPIDLVIDDREGGSKSDSEDVTRSANLTDQ - UNI32979 - PSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQG - UNI32979 - GDG

LDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLT - UNI22728 - - UNI32979 - HPYPSEEQKKQLAQDTGLTILQVNNW 

WFINARRRIVQPMIDQSNRAV VSQGTPYNPDGQPMGGFVMDGQQHMGIRAPG GPMSGMGMNMGMEGQWHYM 
Transcript ENSMUST00000068264
Sequence
GGTCGGAATCCACCTCTCCGCCTGTGCAACACACACTTTACACACGCACGGCGACTGCAAGCGGGCAGCATCGATCGTGGCTCCTTTAAGACAAACTCAG

ACAGACATTTTTTTAACCCTCCTCTCTAATCTCCCTTCAGTGCAGCAGTTGCAAAGAGGGAGAGAGAAAGAGAAAGAGAGCGAGAGAAGAGAGAAACTGA

TTAGGAATTAGGACTGATTCAAGGAAAGCGGGCGCTAGGGCTTTGTGCATTTGAATATTAACATTTGAGGTGTTCTGACCAGAAGAAGACAGAACGGACG

ATCATTCATTCACCACGTTGACAACCTCGCCTGTGATTGACAGCTGGAGTGGCAGAAAGCCATGAGATTTGGTAGTTGGGTCTGAGGGGCGCTCTTTTTT

TTTTTTCTTTTTCTTTTCTTTTCTTTCTTTTTTTTTAAACTGATTTTTTTGGGGGGGAGAGAAGATCTGCTTTTTTTTTCCCCTCCCACTGCTGTCTTGG

TGGAACCAGAGCGCTTTTATGCTCAGCGACGCGGGCGCCTTGCTTCAGGTCCGGTAGACCGAAGATCTGGGACCAGTAATTCACACTGCTGGAGACGCAA

AGGGATTTTTTTTTGTTATTGTTGTGCTTTATTTTTTTTTCCGGGGGAGTTTGCATATTTGTTTCTTTTCACACTGGCCTTAAAGAGGATATATTAGAAG

TTGAAGTAGGAAGGGAGCCAGAGAGGCCGATGGCGCAAAGG TACGACGACCTACCCCATTATGGGGGTATGGATGGAGTAGGCATCCCCTCCACGATGT

ATGGGGACCCGCATGCAGCCAGGTCCATGCAACCGGTCCACCACCTGAACCACGGGCCTCCTCTGCACTCGCATCAGTACCCGCACACAGCTCACACCAA

CGCCATGGCCCCCAGCATGGGTTCCTCGGTCAATGACGCTTTAAAGAGAGATAAAGATGCCATTTATGG ACACCCCCTCTTCCCTCTCTTAGCACTGAT

TTTTGAGAAATGTGAATTAGCTACTTGTACCCCCCGCGAGCCGGGGGTGGCGGGCGGGGACGTCTGCTCGTCAGAGTCATTCAATGAAGATATAGCGGTG

TTCGCCAAACAG ATTCGCGCAGAAAAACCTCTATTCTCTTCTAATCCAGAACTGGATAACTTG ATGATTCAAGCCATACAAGTGTTAAGGTTTCATCT

GTTGGAATTAGAGAAG GTACACGAATTATGTGACAATTTCTGCCACCGGTATATTAGCTGTTTGAAAGGGAAAATGCCTATCGATTTGGTGATAGATGA

TAGAGAAGGAGGATCAAAATCAGACAGTGAAGATGTAACAAGATCAGCAAATCTAACTGACCAG - UNI32979 - CCCTCTTGGAATAGAGACCATG

ATGACACGGCATCCACTCGTTCAGGAGGAACCCCGGGCCCTTCCAGCGGTGGCCATACTTCACACAGTGGGGATAACAGCAGTGAGCAAG - UNI3297

9 - GTGATGGCTTGGACAACAGTGTAGCTTCCCCCAGCACAGGTGACGATGATGACCCTGATAAGGACAAAAAGCGTCACAAAAAGCGTGGCATCTTTC

CCAAAGTAGCCACCAATATCATGAGGGCGTGGCTGTTCCAGCATCTAACA - UNI22728 - - UNI32979 - CACCCTTACCCTTCTGAAGAACA

GAAAAAGCAGTTGGCACAAGATACAGGACTTACCATCCTTCAAGTGAACAATTG GTTTATTAATGCCCGGAGAAGAATAGTGCAGCCCATGATAGACCA

GTCCAACCGAGCAG TCAGCCAAGGGACACCTTATAACCCTGATGGACAGCCAATGGGAGGTTTTGTAATGGACGGTCAGCAGCACATGGGCATCAGAGC

GCCAG GACCTATGAGTGGAATGGGCATGAATATGGGCATGGAGGGGCAGTGGCACTACATGTAACCTTCATCTAGTTAACCAATCGAAAGCCAGGGGGA

A GGCTGCAAAGTATGCCAGGGGAGTATGTAGCCCGGGGTGGCCCAATGGGTGTGAGTATGGGACAGCCGAGTTATACCCAAGCCCAGATGCCCCCCCAT

CCTGCTCAGCTGCGTCATGGGCCCCCCATGCATACGTACATTCCTGGACACCCTCACCACCCCGCAGTGATGATGCATGGAGGACAGCCCCACCCTGGAA

TGCCAATGTCAGCCTCAAGCCCCTCGGTTCTTAACACAGGAGACCCGACAATGAGTGCACAAGTCATGGACATTCACGCTCAGTAGCTTAAGGGAATATG

CGTTGTCTACAATGGTGACTGATCTCGAATCAGGTCTTTTCCTGCAAGGACTATGGAGTTCCATTCTTGACATCTACTTTGGACCAAGGAGCATCCCTAG

TTCTTCATAGGGACTCTTAAAATGCAGGAGAACCATCCGAAGTCAACTCGGGGGACATGCAAAAATAACTATATAAGACATTAAAAGAACAAAGAGTGAA

ATATTGTAAATGCTATTATACTGTTATCCATATTACGTTGTTTCTTATAGATTTTTTAAAAAAAATGTGAAATTTTTCCACACTATGTGTGTTGTTTCCA

TAGCTGTTCACTTCCTCCAGAAGCCTCCTTACATTAAAAAGCCTTACAGTTATCCTGCAAGGGACAGGAAGGTCTGATTTGCAGGATTTTTAGAGCATTA

AAATAACTATCAGGCAGAAGAATCTTTCTTCTTGCCTAGGATTTCAGCCATGTGCGTGCGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCT

CTCTCTCTCTCTCTCTCTTCTCCTCCCTCTCCCTCTTTCTAGCCTGGGGCTTGAATTTGCATGTCTAATTCATTTACTCACCATATTTGAATTGGCCTGA

ACAGATGTAAATCGGGAAGGATGGGAAAAACTGCAGTCACCAACAATGATTAATCAGCTGTTGCAGGCAGTGTCTTAAGGAGACTGGTAGGAGGAGGCAT

GGAAACCCAAAGGCCGTGTGTGTTTAGAAGCCTAACTGTCACATCAAGCATCATCGTCCCCATGCAACAACAACCATCACCTTATACATCACTTCCTGTT

TTATGCAGCTCAAAAAACATAGACTGAAGATTTATTTTTTAATATGTTGACTTTGTTTCTCAGCAAAGCATTGGTCATGTGTGTATTTTTCCATAGTCCC

ACCTTGGAGCATTTATGTAGACATTGTAAATAAATTTTGTGC
Translation
MAQR YDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYG GHPLFPLLALIFEKCELA

TCTPREPGVAGGDVCSSESFNEDIAVFAKQ IRAEKPLFSSNPELDNL MIQAIQVLRFHLLELEK VHELCDNFCHRYISCLKGKMPIDLVIDDREGGS

KSDSEDVTRSANLTDQ - UNI32979 - PSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQG - UNI32979 - GDGLDNSVASPSTGDDDD

PDKDKKRHKKRGIFPKVATNIMRAWLFQHLT - UNI22728 - - UNI32979 - HPYPSEEQKKQLAQDTGLTILQVNNW WFINARRRIVQPMID

QSNRAV VSQGTPYNPDGQPMGGFVMDGQQHMGIRAPG GPMSGMGMNMGMEGQWHYM 
Transcript ENSMUST00000102878
Sequence
GGTCGGAATCCACCTCTCCGCCTGTGCAACACACACTTTACACACGCACGGCGACTGCAAGCGGGCAGCATCGATCGTGGCTCCTTTAAGACAAACTCAG

ACAGACATTTTTTTAACCCTCCTCTCTAATCTCCCTTCAGTGCAGCAGTTGCAAAGAGGGAGAGAGAAAGAGAAAGAGAGCGAGAGAAGAGAGAAACTGA

TTAGGAATTAGGACTGATTCAAGGAAAGCGGGCGCTAGGGCTTTGTGCATTTGAATATTAACATTTGAGGTGTTCTGACCAGAAGAAGACAGAACGGACG

ATCATTCATTCACCACGTTGACAACCTCGCCTGTGATTGACAGCTGGAGTGGCAGAAAGCCATGAGATTTGGTAGTTGGGTCTGAGGGGCGCTCTTTTTT

TTTTTTCTTTTTCTTTTCTTTTCTTTCTTTTTTTTTAAACTGATTTTTTTGGGGGGGAGAGAAGATCTGCTTTTTTTTTCCCCTCCCACTGCTGTCTTGG

TGGAACCAGAGCGCTTTTATGCTCAGCGACGCGGGCGCCTTGCTTCAGGTCCGGTAGACCGAAGATCTGGGACCAGTAATTCACACTGCTGGAGACGCAA

AGGGATTTTTTTTTGTTATTGTTGTGCTTTATTTTTTTTTCCGGGGGAGTTTGCATATTTGTTTCTTTTCACACTGGCCTTAAAGAGGATATATTAGAAG

TTGAAGTAGGAAGGGAGCCAGAGAGGCCGATGGCGCAAAGG TACGACGACCTACCCCATTATGGGGGTATGGATGGAGTAGGCATCCCCTCCACGATGT

ATGGGGACCCGCATGCAGCCAGGTCCATGCAACCGGTCCACCACCTGAACCACGGGCCTCCTCTGCACTCGCATCAGTACCCGCACACAGCTCACACCAA

CGCCATGGCCCCCAGCATGGGTTCCTCGGTCAATGACGCTTTAAAGAGAGATAAAGATGCCATTTATGG ACACCCCCTCTTCCCTCTCTTAGCACTGAT

TTTTGAGAAATGTGAATTAGCTACTTGTACCCCCCGCGAGCCGGGGGTGGCGGGCGGGGACGTCTGCTCGTCAGAGTCATTCAATGAAGATATAGCGGTG

TTCGCCAAACAG ATTCGCGCAGAAAAACCTCTATTCTCTTCTAATCCAGAACTGGATAACTTG ATGATTCAAGCCATACAAGTGTTAAGGTTTCATCT

GTTGGAATTAGAGAAG GTACACGAATTATGTGACAATTTCTGCCACCGGTATATTAGCTGTTTGAAAGGGAAAATGCCTATCGATTTGGTGATAGATGA

TAGAGAAGGAGGATCAAAATCAGACAGTGAAGATGTAACAAGATCAGCAAATCTAACTGACCAG - UNI32979 - CCCTCTTGGAATAGAGACCATG

ATGACACGGCATCCACTCGTTCAGGAGGAACCCCGGGCCCTTCCAGCGGTGGCCATACTTCACACAGTGGGGATAACAGCAGTGAGCAAG - UNI3297

9 - GTGATGGCTTGGACAACAGTGTAGCTTCCCCCAGCACAGGTGACGATGATGACCCTGATAAGGACAAAAAGCGTCACAAAAAGCGTGGCATCTTTC

CCAAAGTAGCCACCAATATCATGAGGGCGTGGCTGTTCCAGCATCTAACA - UNI22728 - - UNI32979 - CACCCTTACCCTTCTGAAGAACA

GAAAAAGCAGTTGGCACAAGATACAGGACTTACCATCCTTCAAGTGAACAATTG GTTTATTAATGCCCGGAGAAGAATAGTGCAGCCCATGATAGACCA

GTCCAACCGAGCAG TCAGCCAAGGGACACCTTATAACCCTGATGGACAGCCAATGGGAGGTTTTGTAATGGACGGTCAGCAGCACATGGGCATCAGAGC

GCCAG GGCTGCAAAGTATGCCAGGGGAGTATGTAGCCCGGGGTGGCCCAATGGGTGTGAGTATGGGACAGCCGAGTTATACCCAAGCCCAGATGCCCCC

CCATCCTGCTCAGCTGCGTCATGGGCCCCCCATGCATACGTACATTCCTGGACACCCTCACCACCCCGCAGTGATGATGCATGGAGGACAGCCCCACCCT

GGAATGCCAATGTCAGCCTCAAGCCCCTCGGTTCTTAACACAGGAGACCCGACAATGAGTGCACAAGTCATGGACATTCACGCTCAGTAGCTTAAGGGAA

TATGCGTTGTCTACAATGGTGACTGATCTCGAATCAGGTCTTTTCCTGCAAGGACTATGGAGTTCCATTCTTGACATCTACTTTGGACCAAGGAGCATCC

CTAGTTCTTCATAGGGACTCTTAAAATGCAGGAGAACCATCCGAAGTCAACTCGGGGGACATGCAAAAATAACTATATAAGACATTAAAAGAACAAAGAG

TGAAATATTGTAAATGCTATTATACTGTTATCCATATTACGTTGTTTCTTATAGATTTTTTAAAAAAAATGTGAAATTTTTCCACACTATGTGTGTTGTT

TCCATAGCTGTTCACTTCCTCCAGAAGCCTCCTTACATTAAAAAGCCTTACAGTTATCCTGCAAGGGACAGGAAGGTCTGATTTGCAGGATTTTTAGAGC

ATTAAAATAACTATCAGGCAGAAGAATCTTTCTTCTTGCCTAGGATTTCAGCCATGTGCGTGCGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCT

CTCTCTCTCTCTCTCTCTCTCTTCTCCTCCCTCTCCCTCTTTCTAGCCTGGGGCTTGAATTTGCATGTCTAATTCATTTACTCACCATATTTGAATTGGC

CTGAACAGATGTAAATCGGGAAGGATGGGAAAAACTGCAGTCACCAACAATGATTAATCAGCTGTTGCAGGCAGTGTCTTAAGGAGACTGGTAGGAGGAG

GCATGGAAACCCAAAGGCCGTGTGTGTTTAGAAGCCTAACTGTCACATCAAGCATCATCGTCCCCATGCAACAACAACCATCACCTTATACATCACTTCC

TGTTTTATGCAGCTCAAAAAACATAGACTGAAGATTTATTTTTTAATATGTTGACTTTGTTTCTCAGCAAAGCATTGGTCATGTGTGTATTTTTCCATAG

TCCCACCTTGGAGCATTTATGTAGACATTGTAAATAAATTTTGTGC
Translation
MAQR YDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYG GHPLFPLLALIFEKCELA

TCTPREPGVAGGDVCSSESFNEDIAVFAKQ IRAEKPLFSSNPELDNL MIQAIQVLRFHLLELEK VHELCDNFCHRYISCLKGKMPIDLVIDDREGGS

KSDSEDVTRSANLTDQ - UNI32979 - PSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQG - UNI32979 - GDGLDNSVASPSTGDDDD

PDKDKKRHKKRGIFPKVATNIMRAWLFQHLT - UNI22728 - - UNI32979 - HPYPSEEQKKQLAQDTGLTILQVNNW WFINARRRIVQPMID

QSNRAV VSQGTPYNPDGQPMGGFVMDGQQHMGIRAPG GLQSMPGEYVARGGPMGVSMGQPSYTQAQMPPHPAQLRHGPPMHTYIPGHPHHPAVMMHGG

QPHPGMPMSASSPSVLNTGDPTMSAQVMDIHAQ

For any suggestions or comments, please send an email to unitrap@crg.es