Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020173 (Cobl)
Chromosomal location
Chr 11: 12136679 - 12364862 (-)
Description
cordon-bleu Gene [Source:MGI (curated);Acc:Cobl-003]
RefSeq_dna
NM_172496 
RefSeq_peptide
NP_766084.3 
UniGene
Mm.22847 
MGI
MGI:105056 
Uniprot/SWISSPROT
Q5NBX1 
Uniprot/SPTREMBL
Q5NBW9 Q5NBX0 B2RWU4 
Human Ortholog
ENSG00000106078 (COBL)
Omim not available
UniTrap UNI15084
Vector Insertion
Chr 11: 12286565 - 12364756
Public Clones (sanger) D136G10 (ggtc) P148G09 (ggtc) D027D10 (ggtc) D184E12 (ggtc)
D009F08 (ggtc) D040C02 (ggtc) P104G03 (ggtc) E033B10 (ggtc) PST13620-NR (escells)
IST10062E2 (tigm) IST12032G10 (tigm) IST14979F6 (tigm) IST14589C6 (tigm)
IST14585C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15950
Vector Insertion
Chr 11: 12286565 - 12286770
Public Clones CMHD-GT_523F7-3 (cmhd)
Private Clones OST469503 (lexicon) OST348667 (lexicon) OST252080 (lexicon) OST215183 (lexicon)
OST198118 (lexicon) OST196985 (lexicon) OST180969 (lexicon) OST172841 (lexicon)
OST148543 (lexicon) OST131525 (lexicon) OST91951 (lexicon) OST68205 (lexicon)
OST51909 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23734
Vector Insertion
Chr 11: 12278151 - 12278363
Public Clones not available
Private Clones OST246511 (lexicon) OST194821 (lexicon) OST189717 (lexicon) OST174548 (lexicon)
OST41655 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9800
Vector Insertion
Chr 11: 12273377 - 12275812
Public Clones RRC053 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28225
Vector Insertion
Chr 11: 12269596 - 12269695
Public Clones not available
Private Clones OST36626 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7131
Vector Insertion
Chr 11: 12243921 - 12265107
Public Clones RRR356 (baygenomics) RRJ505 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI273
Vector Insertion
Chr 11: 12209616 - 12209756
Public Clones GC0441 (tigem) M053A02 (ggtc) A008A02 (ggtc) A053E05 (ggtc) A057A01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2144
Vector Insertion
Chr 11: 12148824 - 12149652
Public Clones AB0031 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093315
Sequence
CAGCGCGGAAAAAGTGAATGAGGACGGCGGCGCCGCAGCCAGCGCCCCAGTCGGCCGGCAGAGCAACCCGCCGGCTCCATGGACGCGCCGCGTGCACTGG

CGGCCAAGCCCCCCACAGG - UNI15084 - - UNI15950 - AAGGAAGATGAAGGCCCGTGCTCCGCCACCTCCTGGAAAGCCTGCTGCCCAGAA

TGTCCACAGCGAACAGAAACTGCCCCATGATGCCACCCTGGGATCCCAGCAAAGCCTGGTCTACATGAAGGAGGCACTGCAGAACAGCACCTTGGACATC

ACCGTGGTTCTGCCCAGTGGACTGGAGAAGCAGAGTGTGGTTAGTGGGAG - UNI15084 - - UNI15950 - - UNI23734 - CCACGCAATG

ATGGACCTACTGGTTGAACTCTGCCTTCAGAACCACCTGAATCCTTCTCACCACGTCCTAGAGATCTGGTCTTCTGAGACCCAACAGCCTTTGAGTTTTA

AGCCAAATACGTTGATTGGGTCCTTGAATGTGCATACTGTACTTCTGAAAGAAAAAGTCCCTGAAGAAAGAGTTAAACCTGGCCTAACCAAGGCTCCTGA

G - UNI23734 - AAATCTGTACGACTGGTAGTGAACTACCTGAGAACGCAGAAGGCTGTCGTGCGGGTGAGCCCTGAGGTGCCACTACAGAATATTC

TGCCAGTCATCTGTGCGAAGTGTGAGGTCAACCCAGAACACGTGATTCTGCTCAGAGACAATGTTGCCGGGGAGGAGCTGGAGCTGTCCAAGTCCCTGAA

TGAACTAGGGATCAAGGAGCTGTATGCGTGGGACAACAGAAGAG - UNI9800 - TTCTTCTGACCAAAACGCAGTCTGAGCCTTCCCTGAGCTGTCA

AG - UNI28225 - AAATGTTTAGAAAATCATCACTTGGCAATGATGAGACAGACAAAGAGAAGAAAAAGTTTCTGGGATTTTTCAAAGCTAATAAAA

GGAGCAACAGTAAG - UNI28225 - GCTGAGCATCTTGGGCTGTCAGGTGCAGATAGTGATGAGGACCCGGCGAAGTCAGCATCTGGAGGGGACTTG

AAC - UNI7131 - GGCTGCGTAACAACACCCAACTCACCATCCTTGCATTCTCGGTCCCTAACACTGGGTCCCTCCCTCTCCCTGGGCAACATCTCT

GGAGTGTCTATGAAGTCAGACATGAAGAAGCGCAGAGCCCCTCCTCCTCCAAGTCCCAAGCTGCTGGGTCAAGACAAGGTATCAGAAAAG - UNI273 

- GCCTCCCTCAGCTCACAGGCTGATCTCCAGAAGAAGAAGAGGCGGGCGCCAGCTCCTCCTCCACCACAGCAGCCACCACCAAGTCCTGTGGTCCCCAA

CCGCAAGGAAGATAAGGAAGAGAACAGGAAGAGCACAGTGG - UNI273 - GTGTTGGACGTCAGGTGCCACAAAAGCCTCCCAGAGGCACAGCTCGG

GGCCCACCCCAGTTAGTGCTCCCCCCGCCCCCACCCTACCCTCCTCCTGACACAGATGTGACAGAGCCTGTCACCTTTCCTGGGGAAGGCGCTGGTTCCG

AGACCTCAGAGCTGAGACCCAAAC TGAGTCTGCCTCTGGGGCCTGGCAGCCACTGCAGCATGGGTGGAGTCTCTCAGGTGCCAGCGGAGAGTGAGGAGA

CAGCATCTGAGGACACAACCGAGGACTCGGGGGTCATGAGCTCTCCCTCAGATGCCATCTCCCTGGACTCACAACAAGACAGCATGAGATCCAAGGACAA

ATGGTCCACAGACCAGGAAGACGGCAGTGACCAGGACCTGGCTGGAACTCCAGAACTGGGTCCCCAAAAGAGCCCATCATGGGGGAAAAGTGGTTCAGGA

AGCTCAATTCTAAG GACTGAGAAAGCCACCATGCCTACCAATGATGATGAAGACCTATTCATCACTGGCCACTTACATCAGACCCTGGCAGAACTTGAT

GAAGACCTGGAAG GAATGGAAGAAAATTATGAAACAGATACTAGCTCTCTAACCAACTCTGTCAATGGTGTATCCAACCACAGTCTGCAAGAAGCCATA

ATCCCTGATAGTGGCGTGGATGACATCCCAGTCACTTTTATCGGGGAAGTTTCTGATGAGCCTTTTGACTCAGGGCTGTTCTCCAGTAGATGTAACAATG

CCACTACTTTTAACACGGGGAGCATTGCTAGCCAAAGATCTCATCTGTCCCCATCTCAGACTGAGCATAGCCAGCCATTCGTAAGGACAAGTAGAAAAGA

GCCTGATCCCTCCCCTCCTTCCCAAGATAACAGGAAGAGAAATCAGCCAACCTTAGCCAACACATCTGAAAATGAGAATCCAGTTGAAACAGACCCCACA

GTTACATCACTTGTTTCAAAGCTTTTAATAGATGACCCAAAAGCAAAGGATAAAGGCAAAGTGCATGGTTCTAGTCACAGTGAGAAGACACAGGCAGGTC

ATGGAATAAACTCACTGCGAGTGAATCCAAGAGATGGTAAGGATGAGAGCTCCAATTCAGCACCCCCACCATGGTCTCATCATGGCCAGGCCTTAGGGGG

AAGCTATGGACTCAAGTATGGCCTCACGACATATAAAATTGTTCCTCCCAAATCAGAGATGAGGTGTTATGACAGGGATGTGTCCCTCTCCACTGGTGCC

ATTAAGATTGATGAACTAGGGAATCTGGTGAGTCCTCACATGAACGGAAGCAGGACCATATCCCCACCATCAGCTGTTGTCGAAACAGACACTCCACCTA

TTGGAAAAGTCAAAGAGTTCTGGAGGCGCAACTCAATGGAAAAGTACCTTAATGGGCCGGCTGAGTGCACTATCAAAAGGGCCCCCTCCACCACTATCAC

TGCCACACCAGAAAAACCACAGCAAGATAATGGGATGAAGGCAGCCTTCACAGTGACCACTCCCCAGCAGCAGCCTGCCTCACAGGAATATGGGGCACAC

CTGGAGGAAGAGAGAAGCCGGCCACAGTCAGCAGTCTCTTGTTCTGTGAAAGTGCCAGCATCTAATCCCACAGACATCACATTCCTCAAGCCTCAAAGAA

GAACATCCAGCCAGTATGTGGCCTCTGCTATTGCCAAGAAGATGGGGCCTCCAAAAGTCCATGCTGATGTGGTGAGACCACATAAGGCAACCACTGAACA

GTGTCATGAAGAAGCAAAGCTGGCTAGATCTCCTCCCACCAGGAAAGATGATGCAGCTCCCAACCTACACTCAGAGGCAAGGCAGCATGAACATGGGACA

AACCAGAGCTCTGTCTGCCTTCCCAGCAACCCTGGTGTGCAATTGCCAGCAGGAGGCCATCCCAAAGTAGAGGTCAACAGCACATATGGGAAGTCATCGA

CTCAAGACTATCCTGCTGCTGTCCACAGAAACTCCTATTTCCTCCCAGGCAGATCTTCCCATAGGGATCGTGTTTCTGTGGGACAGAGCTGTGGTTTCAA

TGAAAAGCAAACTACAAGTAACCAAAAGGCAAATTCAACATCTAACTTCTCGCAGGCACTGGACAAGGCGCATCCACCCCCTCTGCTCTTGGCAGAGGCC

CGTGACTCTGGGAGGATACTGATGAATGGCTCTGCACGAACCCCAGGAAATTGTGAGCCCCCCCACTCTCCAAAAGAATCCACCCTGACTAGCTATATTA

TCTTACAGACAGAGGAAAAGCCCAGTTCGTTATCTACAGATGGTCAAGACGCAGATGATACTCTACCGTCCAGCATTTTTGGGCCAAAGAAAAAGTTCAA

GCCTGTCATTCAAAGGCCACTCCCAAAAGATGTATCCCTGCACAGTGCCCTGATGGAAGCTATCCACTCATCAGGAGGGAGAGAAAAGCTCCGGAAGGT 

TGCAGAACAGACGTCAGAAGGAAGGCCAAAGAAACCATCCTACGTGGAGGCAGAGAGTGAGCGATCTGCCCTTCTGGCAGCCATTCGGGGTCACAGTGGG

ACTCTCAGCCTCAGGAAG GTGTCATCCCTTGCCTCTGAGGAGCTCCAGAGCTTCCGCAATGCTGCACTCGGGGCTCCAGGTTTGGATAAACCTCAGCAA

GAAGACCTTGGCCTTCCACCCCCACCTGCCCTGCCACCACCACCCGCTCCAGCCCCCCAGGCTCCTTCAGCCTCCGTAACAGTTTCTAGGTTCAGCACCG

GCACCCCCAGCAACTCAGTGAATGCTAGACAAGCCTTGATGGATGCCATCCGCTCGGGCACAGGAGCTGCAAGACTAAGAAAG - UNI2144 - GTTC

CCTTGCTCGTGTGAAGTCCTACCACTGAAGAGACCACCTGTACAGCTCCAAGTATCATCACTTTAGAAATCCACATGACAGGAAATGAAACCTTCAAGAA

GTGGCGGTACTTTCCTGTCTCCAGGCCAACTTGCCCACGGTGGATTTTCAGTGTTCCTACATAATGGTCAAAGAGGAGATACTGCTTTGCTGTGTGACTT

GTGTGCCAAGGACATATGATCTGCCTCTGAATGCTCACAGTTGCCAATAAACTGCTCTTGTTGGCAGAGTAATGGGAATACACAGGCTGGAGCCCAGCAC

TCACACTTGATTTTAGCTATGGGCACAAGGAATTATGCCCTAAGTTGATTTTTGGATCTTTGAGACTTTGACCACATACACATGGTTAAAATCACTTATG

ATCCTTTGAATTCTAGGTGTACAAAAACATAAATCAACAGAAATAGTCAGAATCTATTACATGCTCCAGGATGCTGCTTCTGGAGTAAGAAGCACCATGG

AGGAAGGCTGCTGAGATGACTTTTGCAGGATAAGAAAGCGTCAGATTCGTATTTGTATTCCTCACACAGTGAAGCCTCACACCTCACAGATGATCTTGGA

CTGTGATCTGACCAACTAGCTTTTAAAATTCCACTGTTGCTGCCCAGAATAGCAGCCCTACTTGACCCTCTGAGCAAGACATTCCTGGCTCCTTAGAAGA

TGATGGGAAGCAGAGATGAGAACACTGGAAGGGTTGTCCGTTTTCTGTATAGATGTGTCCCACTTGTATAGTTTCCCCCCTCCCCCATCCCCAGTGTCCC

AGAAGGCTATGACATGCATCAGGTTACTGTGAAGGAGCCTTGCATGGAGCCTGAGATTTCACCAGTAGCCTTCTGAAATCCTGCACAGGGCCAGAGAGCA

GAGTGTTGAGGACCTATATGTAGCAGAGGGCAGTCCACATTGTGCTGCACATTCTGTGGCTTACATTTTATCCTGACACACTTTGGCATGGTCCAGCAGC

TGCCCTGGTATTATATGACATTCTTATAGTACATTGTGGGTAGACACCATCTTTAAAGAATTTAAACTCAGCAGGAAGTTTTGTGATTTTTTTTAATGTA

TCTCTAAAACCTTTTCTTATATGGAGAAAATCAAGACAGCAATATAAGTCAAAATGAGTTCATGATATAAAATCTCTGCCTTACTGAAAAAAAAATGAAA

TCCTTTTACTATTTCCCCCTGTTTTAAATCTAGGCATCGGGTAGAGTGGGAACTTGGTATTGTGTGATTAACATTGCTAAACTTTCTCAGTGAGGCAAGA

GCTACCAGCCAATTGCTCTTAGTCACAGCTGTCTGCTCTTTCTCTTAGTGCCACAAATAAATGCAAATCCAATGCTGT
Translation
 - UNI15084 - - UNI15950 -  - UNI15084 - - UNI15950 - - UNI23734 - MDLLVELCLQNHLNPSHHVLEIWSSETQQPLSF

KPNTLIGSLNVHTVLLKEKVPEERVKPGLTKAPE - UNI23734 - KSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVAG

EELELSKSLNELGIKELYAWDNRRV - UNI9800 - VLLTKTQSEPSLSCQE - UNI28225 - EMFRKSSLGNDETDKEKKKFLGFFKANKRSNS

K - UNI28225 - AEHLGLSGADSDEDPAKSASGGDLN - UNI7131 - GCVTTPNSPSLHSRSLTLGPSLSL - UNI273 -  - UNI273 -

       - UNI2144 - 
Transcript ENSMUST00000109649
Sequence
CAGCGCGGAAAAAGTGAATGAGGACGGCGGCGCCGCAGCCAGCGCCCCAGTCGGCCGGCAGAGCAACCCGCCGGCTCCATGGACGCGCCGCGTGCACTGG

CGGCCAAGCCCCCCACAGG - UNI15084 - - UNI15950 - AAGGAAGATGAAGGCCCGTGCTCCGCCACCTCCTGGAAAGCCTGCTGCCCAGAA

TGTCCACAGCGAACAGAAACTGCCCCATGATGCCACCCTGGGATCCCAGCAAAGCCTGGTCTACATGAAGGAGGCACTGCAGAACAGCACCTTGGACATC

ACCGTGGTTCTGCCCAGTGGACTGGAGAAGCAGAGTGTGGTTAGTGGGAG - UNI15084 - - UNI15950 - - UNI23734 - CCACGCAATG

ATGGACCTACTGGTTGAACTCTGCCTTCAGAACCACCTGAATCCTTCTCACCACGTCCTAGAGATCTGGTCTTCTGAGACCCAACAGCCTTTGAGTTTTA

AGCCAAATACGTTGATTGGGTCCTTGAATGTGCATACTGTACTTCTGAAAGAAAAAGTCCCTGAAGAAAGAGTTAAACCTGGCCTAACCAAGGCTCCTGA

G - UNI23734 - AAATCTGTACGACTGGTAGTGAACTACCTGAGAACGCAGAAGGCTGTCGTGCGGGTGAGCCCTGAGGTGCCACTACAGAATATTC

TGCCAGTCATCTGTGCGAAGTGTGAGGTCAACCCAGAACACGTGATTCTGCTCAGAGACAATGTTGCCGGGGAGGAGCTGGAGCTGTCCAAGTCCCTGAA

TGAACTAGGGATCAAGGAGCTGTATGCGTGGGACAACAGAAGAG - UNI9800 - - UNI28225 - AAATGTTTAGAAAATCATCACTTGGCAATG

ATGAGACAGACAAAGAGAAGAAAAAGTTTCTGGGATTTTTCAAAGCTAATAAAAGGAGCAACAGTAAG - UNI28225 - GCTGAGCATCTTGGGCTG

TCAGGTGCAGATAGTGATGAGGACCCGGCGAAGTCAGCATCTGGAGGGGACTTGAAC - UNI7131 - GGCTGCGTAACAACACCCAACTCACCATCC

TTGCATTCTCGGTCCCTAACACTGGGTCCCTCCCTCTCCCTGGGCAACATCTCTGGAGTGTCTATGAAGTCAGACATGAAGAAGCGCAGAGCCCCTCCTC

CTCCAAGTCCCAAGCTGCTGGGTCAAGACAAGGTATCAGAAAAG AAAGTTCCAG AGATGGTA
Translation
MDAPRALAAKPPTG - UNI15084 - - UNI15950 - GRKMKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSG

LEKQSVVSGS - UNI15084 - - UNI15950 - - UNI23734 - SHAMMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHT

VLLKEKVPEERVKPGLTKAPE - UNI23734 - KSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVAGEELELSKSLNELG

IKELYAWDNRRE - UNI9800 - - UNI28225 - EMFRKSSLGNDETDKEKKKFLGFFKANKRSNSK - UNI28225 - AEHLGLSGADSDEDP

AKSASGGDLN - UNI7131 - GCVTTPNSPSLHSRSLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEK KVPE EMV
Transcript ENSMUST00000093316
Sequence
AGTCGGCCGGCAGAGCAACCCGCCGGCTCCATGGACGCGCCGCGTGCACTGGCGGCCAAGCCCCCCACAGG - UNI15084 - - UNI15950 - AA

GGAAGATGAAGGCCCGTGCTCCGCCACCTCCTGGAAAGCCTGCTGCCCAGAATGTCCACAGCGAACAGAAACTGCCCCATGATGCCACCCTGGGATCCCA

GCAAAGCCTGGTCTACATGAAGGAGGCACTGCAGAACAGCACCTTGGACATCACCGTGGTTCTGCCCAGTGGACTGGAGAAGCAGAGTGTGGTTAGTGGG

AG - UNI15084 - - UNI15950 - - UNI23734 - CCACGCAATGATGGACCTACTGGTTGAACTCTGCCTTCAGAACCACCTGAATCCTTCT

CACCACGTCCTAGAGATCTGGTCTTCTGAGACCCAACAGCCTTTGAGTTTTAAGCCAAATACGTTGATTGGGTCCTTGAATGTGCATACTGTACTTCTGA

AAGAAAAAGTCCCTGAAGAAAGAGTTAAACCTGGCCTAACCAAGGCTCCTGAG - UNI23734 - AAATCTGTACGACTGGTAGTGAACTACCTGAGA

ACGCAGAAGGCTGTCGTGCGGGTGAGCCCTGAGGTGCCACTACAGAATATTCTGCCAGTCATCTGTGCGAAGTGTGAGGTCAACCCAGAACACGTGATTC

TGCTCAGAGACAATGTTGCCGGGGAGGAGCTGGAGCTGTCCAAGTCCCTGAATGAACTAGGGATCAAGGAGCTGTATGCGTGGGACAACAGAAGAG - U

NI9800 - - UNI28225 - AAATGTTTAGAAAATCATCACTTGGCAATGATGAGACAGACAAAGAGAAGAAAAAGTTTCTGGGATTTTTCAAAGCTA

ATAAAAGGAGCAACAGTAAG - UNI28225 - GCTGAGCATCTTGGGCTGTCAGGTGCAGATAGTGATGAGGACCCGGCGAAGTCAGCATCTGGAGGG

GACTTGAAC - UNI7131 - GGCTGCGTAACAACACCCAACTCACCATCCTTGCATTCTCGGTCCCTAACACTGGGTCCCTCCCTCTCCCTGGGCAAC

ATCTCTGGAGTGTCTATGAAGTCAGACATGAAGAAGCGCAGAGCCCCTCCTCCTCCAAGTCCCAAGCTGCTGGGTCAAGACAAGGTATCAGAAAAG - U

NI273 - GCCTCCCTCAGCTCACAGGCTGATCTCCAGAAGAAGAAGAGGCGGGCGCCAGCTCCTCCTCCACCACAGCAGCCACCACCAAGTCCTGTGGT

CCCCAACCGCAAGGAAGATAAGGAAGAGAACAGGAAGAGCACAGTGG - UNI273 - TTTATTGCTGTGCGTCGTTCCCTACGCATGCCAAGCGTTCC

TGA
Translation
 - UNI15084 - - UNI15950 -  - UNI15084 - - UNI15950 - - UNI23734 -  - UNI23734 -  - UNI9800 - - UNI2

8225 - MFRKSSLGNDETDKEKKKFLGFFKANKRSNSK - UNI28225 - AEHLGLSGADSDEDPAKSASGGDLN - UNI7131 - GCVTTPNSP

SLHSRSLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEK - UNI273 - ASLSSQADLQKKKRRAPAPPPPQQPPPSPVVPNRKEDKE

ENRKSTVV - UNI273 - VYCCASFPTHAKRS
Transcript ENSMUST00000093317
Sequence
CAGCGCGGAAAAAGTGAATGAGGACGGCGGCGCCGCAGCCAGCGCCCCAGTCGGCCGGCAGAGCAACCCGCCGGCTCCATGGACGCGCCGCGTGCACTGG

CGGCCAAGCCCCCCACAGG - UNI15084 - - UNI15950 - AAGGAAGATGAAGGCCCGTGCTCCGCCACCTCCTGGAAAGCCTGCTGCCCAGAA

TGTCCACAGCGAACAGAAACTGCCCCATGATGCCACCCTGGGATCCCAGCAAAGCCTGGTCTACATGAAGGAGGCACTGCAGAACAGCACCTTGGACATC

ACCGTGGTTCTGCCCAGTGGACTGGAGAAGCAGAGTGTGGTTAGTGGGAG - UNI15084 - - UNI15950 - - UNI23734 - CCACGCAATG

ATGGACCTACTGGTTGAACTCTGCCTTCAGAACCACCTGAATCCTTCTCACCACGTCCTAGAGATCTGGTCTTCTGAGACCCAACAGCCTTTGAGTTTTA

AGCCAAATACGTTGATTGGGTCCTTGAATGTGCATACTGTACTTCTGAAAGAAAAAGTCCCTGAAGAAAGAGTTAAACCTGGCCTAACCAAGGCTCCTGA

G - UNI23734 - AAATCTGTACGACTGGTAGTGAACTACCTGAGAACGCAGAAGGCTGTCGTGCGGGTGAGCCCTGAGGTGCCACTACAGAATATTC

TGCCAGTCATCTGTGCGAAGTGTGAGGTCAACCCAGAACACGTGATTCTGCTCAGAGACAATGTTGCCGGGGAGGAGCTGGAGCTGTCCAAGTCCCTGAA

TGAACTAGGGATCAAGGAGCTGTATGCGTGGGACAACAGAAGAG - UNI9800 - - UNI28225 - AAATGTTTAGAAAATCATCACTTGGCAATG

ATGAGACAGACAAAGAGAAGAAAAAGTTTCTGGGATTTTTCAAAGCTAATAAAAGGAGCAACAGTAAG - UNI7131 - - UNI28225 - GGCTGC

GTAACAACACCCAACTCACCATCCTTGCATTCTCGGTCCCTAACACTGGGTCCCTCCCTCTCCCTGGGCAACATCTCTGGAGTGTCTATGAAGTCAGACA

TGAAGAAGCGCAGAGCCCCTCCTCCTCCAAGTCCCAAGCTGCTGGGTCAAGACAAGGTATCAGAAAAG - UNI273 - GCCTCCCTCAGCTCACAGGC

TGATCTCCAGAAGAAGAAGAGGCGGGCGCCAGCTCCTCCTCCACCACAGCAGCCACCACCAAGTCCTGTGGTCCCCAACCGCAAGGAAGATAAGGAAGAG

AACAGGAAGAGCACAGTGG - UNI273 - TGAGTCTGCCTCTGGGGCCTGGCAGCCACTGCAGCATGGGTGGAGTCTCTCAGGTGCCAGCGGAGAGTG

AGGAGACAGCATCTGAGGACACAACCGAGGACTCGGGGGTCATGAGCTCTCCCTCAGATGCCATCTCCCTGGACTCACAACAAGACAGCATGAGATCCAA

GGACAAATGGTCCACAGACCAGGAAGACGGCAGTGACCAGGACCTGGCTGGAACTCCAGAACTGGGTCCCCAAAAGAGCCCATCATGGGGGAAAAGTGGT

TCAGGAAGCTCAATTCTAAG GACTGAGAAAGCCACCATGCCTACCAATGATGATGAAGACCTATTCATCACTGGCCACTTACATCAGACCCTGGCAGAA

CTTGATGAAGACCTGGAAG GAATGGAAGAAAATTATGAAACAGATACTAGCTCTCTAACCAACTCTGTCAATGGTGTATCCAACCACAGTCTGCAAGAA

GCCATAATCCCTGATAGTGGCGTGGATGACATCCCAGTCACTTTTATCGGGGAAGTTTCTGATGAGCCTTTTGACTCAGGGCTGTTCTCCAGTAGATGTA

ACAATGCCACTACTTTTAACACGGGGAGCATTGCTAGCCAAAGATCTCATCTGTCCCCATCTCAGACTGAGCATAGCCAGCCATTCGTAAGGACAAGTAG

AAAAGAGCCTGATCCCTCCCCTCCTTCCCAAGATAACAGGAAGAGAAATCAGCCAACCTTAGCCAACACATCTGAAAATGAGAATCCAGTTGAAACAGAC

CCCACAGTTACATCACTTGTTTCAAAGCTTTTAATAGATGACCCAAAAGCAAAGGATAAAGGCAAAGTGCATGGTTCTAGTCACAGTGAGAAGACACAGG

CAGGTCATGGAATAAACTCACTGCGAGTGAATCCAAGAGATGGTAAGGATGAGAGCTCCAATTCAGCACCCCCACCATGGTCTCATCATGGCCAGGCCTT

AGGGGGAAGCTATGGACTCAAGTATGGCCTCACGACATATAAAATTGTTCCTCCCAAATCAGAGATGAGGTGTTATGACAGGGATGTGTCCCTCTCCACT

GGTGCCATTAAGATTGATGAACTAGGGAATCTGGTGAGTCCTCACATGAACGGAAGCAGGACCATATCCCCACCATCAGCTGTTGTCGAAACAGACACTC

CACCTATTGGAAAAGTCAAAGAGTTCTGGAGGCGCAACTCAATGGAAAAGTACCTTAATGGGCCGGCTGAGTGCACTATCAAAAGGGCCCCCTCCACCAC

TATCACTGCCACACCAGAAAAACCACAGCAAGATAATGGGATGAAGGCAGCCTTCACAGTGACCACTCCCCAGCAGCAGCCTGCCTCACAGGAATATGGG

GCACACCTGGAGGAAGAGAGAAGCCGGCCACAGTCAGCAGTCTCTTGTTCTGTGAAAGTGCCAGCATCTAATCCCACAGACATCACATTCCTCAAGCCTC

AAAGAAGAACATCCAGCCAGTATGTGGCCTCTGCTATTGCCAAGAAGATGGGGCCTCCAAAAGTCCATGCTGATGTGGTGAGACCACATAAGGCAACCAC

TGAACAGTGTCATGAAGAAGCAAAGCTGGCTAGATCTCCTCCCACCAGGAAAGATGATGCAGCTCCCAACCTACACTCAGAGGCAAGGCAGCATGAACAT

GGGACAAACCAGAGCTCTGTCTGCCTTCCCAGCAACCCTGGTGTGCAATTGCCAGCAGGAGGCCATCCCAAAGTAGAGGTCAACAGCACATATGGGAAGT

CATCGACTCAAGACTATCCTGCTGCTGTCCACAGAAACTCCTATTTCCTCCCAGGCAGATCTTCCCATAGGGATCGTGTTTCTGTGGGACAGAGCTGTGG

TTTCAATGAAAAGCAAACTACAAGTAACCAAAAGGCAAATTCAACATCTAACTTCTCGCAGGCACTGGACAAGGCGCATCCACCCCCTCTGCTCTTGGCA

GAGGCCCGTGACTCTGGGAGGATACTGATGAATGGCTCTGCACGAACCCCAGGAAATTGTGAGCCCCCCCACTCTCCAAAAGAATCCACCCTGACTAGCT

ATATTATCTTACAGACAGAGGAAAAGCCCAGTTCGTTATCTACAGATGGTCAAGACGCAGATGATACTCTACCGTCCAGCATTTTTGGGCCAAAGAAAAA

GTTCAAGCCTGTCATTCAAAGGCCACTCCCAAAAGATGTATCCCTGCACAGTGCCCTGATGGAAGCTATCCACTCATCAGGAGGGAGAGAAAAGCTCCGG

AAG ACTGCAGAACAGACGTCAGAAGGAAGGCCAAAGAAACCATCCTACGTGGAGGCAGAGAGTGAGCGATCTGCCCTTCTGGCAGCCATTCGGGGTCAC

AGTGGGACTCTCAGCCTCAGGAAG GTGTCATCCCTTGCCTCTGAGGAGCTCCAGAGCTTCCGCAATGCTGCACTCGGGGCTCCAGGTTTGGATAAACCT

CAGCAAGAAGACCTTGGCCTTCCACCCCCACCTGCCCTGCCACCACCACCCGCTCCAGCCCCCCAGGCTCCTTCAGCCTCCGTAACAGTTTCTAGGTTCA

GCACCGGCACCCCCAGCAACTCAGTGAATGCTAGACAAGCCTTGATGGATGCCATCCGCTCGGGCACAGGAGCTGCAAGACTAAGAAAG - UNI2144 

- ACACCTCTTGTGGTG
Translation
MDAPRALAAKPPTG - UNI15084 - - UNI15950 - GRKMKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSG

LEKQSVVSGS - UNI15084 - - UNI15950 - - UNI23734 - SHAMMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHT

VLLKEKVPEERVKPGLTKAPE - UNI23734 - KSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVAGEELELSKSLNELG

IKELYAWDNRRE - UNI9800 - - UNI28225 - EMFRKSSLGNDETDKEKKKFLGFFKANKRSNSK - UNI7131 - - UNI28225 - GCV

TTPNSPSLHSRSLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEK - UNI273 - ASLSSQADLQKKKRRAPAPPPPQQPPPSPVVPN

RKEDKEENRKSTVV - UNI273 - VSLPLGPGSHCSMGGVSQVPAESEETASEDTTEDSGVMSSPSDAISLDSQQDSMRSKDKWSTDQEDGSDQDLAG

TPELGPQKSPSWGKSGSGSSILR RTEKATMPTNDDEDLFITGHLHQTLAELDEDLEG GMEENYETDTSSLTNSVNGVSNHSLQEAIIPDSGVDDIPVT

FIGEVSDEPFDSGLFSSRCNNATTFNTGSIASQRSHLSPSQTEHSQPFVRTSRKEPDPSPPSQDNRKRNQPTLANTSENENPVETDPTVTSLVSKLLIDD

PKAKDKGKVHGSSHSEKTQAGHGINSLRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGLTTYKIVPPKSEMRCYDRDVSLSTGAIKIDELGNLVSP

HMNGSRTISPPSAVVETDTPPIGKVKEFWRRNSMEKYLNGPAECTIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQEYGAHLEEERSRPQSAV

SCSVKVPASNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKATTEQCHEEAKLARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPG

VQLPAGGHPKVEVNSTYGKSSTQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQKANSTSNFSQALDKAHPPPLLLAEARDSGRILMNGSA

RTPGNCEPPHSPKESTLTSYIILQTEEKPSSLSTDGQDADDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGREKLRK TAEQTSEGRPKK

PSYVEAESERSALLAAIRGHSGTLSLRK VSSLASEELQSFRNAALGAPGLDKPQQEDLGLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQ

ALMDAIRSGTGAARLRK - UNI2144 - TPLVV
Transcript ENSMUST00000046755
Sequence
CAGCGCGGAAAAAGTGAATGAGGACGGCGGCGCCGCAGCCAGCGCCCCAGTCGGCCGGCAGAGCAACCCGCCGGCTCCATGGACGCGCCGCGTGCACTGG

CGGCCAAGCCCCCCACAGG - UNI15084 - - UNI15950 - AAGGAAGATGAAGGCCCGTGCTCCGCCACCTCCTGGAAAGCCTGCTGCCCAGAA

TGTCCACAGCGAACAGAAACTGCCCCATGATGCCACCCTGGGATCCCAGCAAAGCCTGGTCTACATGAAGGAGGCACTGCAGAACAGCACCTTGGACATC

ACCGTGGTTCTGCCCAGTGGACTGGAGAAGCAGAGTGTGGTTAGTGGGAG - UNI15084 - - UNI15950 - - UNI23734 - CCACGCAATG

ATGGACCTACTGGTTGAACTCTGCCTTCAGAACCACCTGAATCCTTCTCACCACGTCCTAGAGATCTGGTCTTCTGAGACCCAACAGCCTTTGAGTTTTA

AGCCAAATACGTTGATTGGGTCCTTGAATGTGCATACTGTACTTCTGAAAGAAAAAGTCCCTGAAGAAAGAGTTAAACCTGGCCTAACCAAGGCTCCTGA

G - UNI23734 - AAATCTGTACGACTGGTAGTGAACTACCTGAGAACGCAGAAGGCTGTCGTGCGGGTGAGCCCTGAGGTGCCACTACAGAATATTC

TGCCAGTCATCTGTGCGAAGTGTGAGGTCAACCCAGAACACGTGATTCTGCTCAGAGACAATGTTGCCGGGGAGGAGCTGGAGCTGTCCAAGTCCCTGAA

TGAACTAGGGATCAAGGAGCTGTATGCGTGGGACAACAGAAGAG - UNI9800 - - UNI28225 - AAATGTTTAGAAAATCATCACTTGGCAATG

ATGAGACAGACAAAGAGAAGAAAAAGTTTCTGGGATTTTTCAAAGCTAATAAAAGGAGCAACAGTAAG - UNI28225 - GCTGAGCATCTTGGGCTG

TCAGGTGCAGATAGTGATGAGGACCCGGCGAAGTCAGCATCTGGAGGGGACTTGAAC - UNI7131 - GGCTGCGTAACAACACCCAACTCACCATCC

TTGCATTCTCGGTCCCTAACACTGGGTCCCTCCCTCTCCCTGGGCAACATCTCTGGAGTGTCTATGAAGTCAGACATGAAGAAGCGCAGAGCCCCTCCTC

CTCCAAGTCCCAAGCTGCTGGGTCAAGACAAGGTATCAGAAAAG - UNI273 - GCCTCCCTCAGCTCACAGGCTGATCTCCAGAAGAAGAAGAGGCG

GGCGCCAGCTCCTCCTCCACCACAGCAGCCACCACCAAGTCCTGTGGTCCCCAACCGCAAGGAAGATAAGGAAGAGAACAGGAAGAGCACAGTGG - UN

I273 - GTGTTGGACGTCAGGTGCCACAAAAGCCTCCCAGAGGCACAGCTCGGGGCCCACCCCAGTTAGTGCTCCCCCCGCCCCCACCCTACCCTCCTC

CTGACACAGATGTGACAGAGCCTGTCACCTTTCCTGGGGAAGGCGCTGGTTCCGAGACCTCAGAGCTGAGACCCAAAC TGAGTCTGCCTCTGGGGCCTG

GCAGCCACTGCAGCATGGGTGGAGTCTCTCAGGTGCCAGCGGAGAGTGAGGAGACAGCATCTGAGGACACAACCGAGGACTCGGGGGTCATGAGCTCTCC

CTCAGATGCCATCTCCCTGGACTCACAACAAGACAGCATGAGATCCAAGGACAAATGGTCCACAGACCAGGAAGACGGCAGTGACCAGGACCTGGCTGGA

ACTCCAGAACTGGGTCCCCAAAAGAGCCCATCATGGGGGAAAAGTGGTTCAGGAAGCTCAATTCTAAG GACTGAGAAAGCCACCATGCCTACCAATGAT

GATGAAGACCTATTCATCACTGGCCACTTACATCAGACCCTGGCAGAACTTGATGAAGACCTGGAAG GAATGGAAGAAAATTATGAAACAGATACTAGC

TCTCTAACCAACTCTGTCAATGGTGTATCCAACCACAGTCTGCAAGAAGCCATAATCCCTGATAGTGGCGTGGATGACATCCCAGTCACTTTTATCGGGG

AAGTTTCTGATGAGCCTTTTGACTCAGGGCTGTTCTCCAGTAGATGTAACAATGCCACTACTTTTAACACGGGGAGCATTGCTAGCCAAAGATCTCATCT

GTCCCCATCTCAGACTGAGCATAGCCAGCCATTCGTAAGGACAAGTAGAAAAGAGCCTGATCCCTCCCCTCCTTCCCAAGATAACAGGAAGAGAAATCAG

CCAACCTTAGCCAACACATCTGAAAATGAGAATCCAGTTGAAACAGACCCCACAGTTACATCACTTGTTTCAAAGCTTTTAATAGATGACCCAAAAGCAA

AGGATAAAGGCAAAGTGCATGGTTCTAGTCACAGTGAGAAGACACAGGCAGGTCATGGAATAAACTCACTGCGAGTGAATCCAAGAGATGGTAAGGATGA

GAGCTCCAATTCAGCACCCCCACCATGGTCTCATCATGGCCAGGCCTTAGGGGGAAGCTATGGACTCAAGTATGGCCTCACGACATATAAAATTGTTCCT

CCCAAATCAGAGATGAGGTGTTATGACAGGGATGTGTCCCTCTCCACTGGTGCCATTAAGATTGATGAACTAGGGAATCTGGTGAGTCCTCACATGAACG

GAAGCAGGACCATATCCCCACCATCAGCTGTTGTCGAAACAGACACTCCACCTATTGGAAAAGTCAAAGAGTTCTGGAGGCGCAACTCAATGGAAAAGTA

CCTTAATGGGCCGGCTGAGTGCACTATCAAAAGGGCCCCCTCCACCACTATCACTGCCACACCAGAAAAACCACAGCAAGATAATGGGATGAAGGCAGCC

TTCACAGTGACCACTCCCCAGCAGCAGCCTGCCTCACAGGAATATGGGGCACACCTGGAGGAAGAGAGAAGCCGGCCACAGTCAGCAGTCTCTTGTTCTG

TGAAAGTGCCAGCATCTAATCCCACAGACATCACATTCCTCAAGCCTCAAAGAAGAACATCCAGCCAGTATGTGGCCTCTGCTATTGCCAAGAAGATGGG

GCCTCCAAAAGTCCATGCTGATGTGGTGAGACCACATAAGGCAACCACTGAACAGTGTCATGAAGAAGCAAAGCTGGCTAGATCTCCTCCCACCAGGAAA

GATGATGCAGCTCCCAACCTACACTCAGAGGCAAGGCAGCATGAACATGGGACAAACCAGAGCTCTGTCTGCCTTCCCAGCAACCCTGGTGTGCAATTGC

CAGCAGGAGGCCATCCCAAAGTAGAGGTCAACAGCACATATGGGAAGTCATCGACTCAAGACTATCCTGCTGCTGTCCACAGAAACTCCTATTTCCTCCC

AGGCAGATCTTCCCATAGGGATCGTGTTTCTGTGGGACAGAGCTGTGGTTTCAATGAAAAGCAAACTACAAGTAACCAAAAGGCAAATTCAACATCTAAC

TTCTCGCAGGCACTGGACAAGGCGCATCCACCCCCTCTGCTCTTGGCAGAGGCCCGTGACTCTGGGAGGATACTGATGAATGGCTCTGCACGAACCCCAG

GAAATTGTGAGCCCCCCCACTCTCCAAAAGAATCCACCCTGACTAGCTATATTATCTTACAGACAGAGGAAAAGCCCAGTTCGTTATCTACAGATGGTCA

AGACGCAGATGATACTCTACCGTCCAGCATTTTTGGGCCAAAGAAAAAGTTCAAGCCTGTCATTCAAAGGCCACTCCCAAAAGATGTATCCCTGCACAGT

GCCCTGATGGAAGCTATCCACTCATCAGGAGGGAGAGAAAAGCTCCGGAAG ACTGCAGAACAGACGTCAGAAGGAAGGCCAAAGAAACCATCCTACGTG

GAGGCAGAGAGTGAGCGATCTGCCCTTCTGGCAGCCATTCGGGGTCACAGTGGGACTCTCAGCCTCAGGAAG GTGTCATCCCTTGCCTCTGAGGAGCTC

CAGAGCTTCCGCAATGCTGCACTCGGGGCTCCAGGTTTGGATAAACCTCAGCAAGAAGACCTTGGCCTTCCACCCCCACCTGCCCTGCCACCACCACCCG

CTCCAGCCCCCCAGGCTCCTTCAGCCTCCGTAACAGTTTCTAGGTTCAGCACCGGCACCCCCAGCAACTCAGTGAATGCTAGACAAGCCTTGATGGATGC

CATCCGCTCGGGCACAGGAGCTGCAAGACTAAGAAAG - UNI2144 - ACACCTCTTGTGGTG
Translation
MDAPRALAAKPPTG - UNI15084 - - UNI15950 - GRKMKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSG

LEKQSVVSGS - UNI15084 - - UNI15950 - - UNI23734 - SHAMMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHT

VLLKEKVPEERVKPGLTKAPE - UNI23734 - KSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVAGEELELSKSLNELG

IKELYAWDNRRE - UNI9800 - - UNI28225 - EMFRKSSLGNDETDKEKKKFLGFFKANKRSNSK - UNI28225 - AEHLGLSGADSDEDP

AKSASGGDLN - UNI7131 - GCVTTPNSPSLHSRSLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEK - UNI273 - ASLSSQA

DLQKKKRRAPAPPPPQQPPPSPVVPNRKEDKEENRKSTVG - UNI273 - GVGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVTEPVTFPGEGAG

SETSELRPKL LSLPLGPGSHCSMGGVSQVPAESEETASEDTTEDSGVMSSPSDAISLDSQQDSMRSKDKWSTDQEDGSDQDLAGTPELGPQKSPSWGKS

GSGSSILR RTEKATMPTNDDEDLFITGHLHQTLAELDEDLEG GMEENYETDTSSLTNSVNGVSNHSLQEAIIPDSGVDDIPVTFIGEVSDEPFDSGLF

SSRCNNATTFNTGSIASQRSHLSPSQTEHSQPFVRTSRKEPDPSPPSQDNRKRNQPTLANTSENENPVETDPTVTSLVSKLLIDDPKAKDKGKVHGSSHS

EKTQAGHGINSLRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGLTTYKIVPPKSEMRCYDRDVSLSTGAIKIDELGNLVSPHMNGSRTISPPSAVV

ETDTPPIGKVKEFWRRNSMEKYLNGPAECTIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQEYGAHLEEERSRPQSAVSCSVKVPASNPTDIT

FLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKATTEQCHEEAKLARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPGVQLPAGGHPKVEVNS

TYGKSSTQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQKANSTSNFSQALDKAHPPPLLLAEARDSGRILMNGSARTPGNCEPPHSPKES

TLTSYIILQTEEKPSSLSTDGQDADDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGREKLRK TAEQTSEGRPKKPSYVEAESERSALLA

AIRGHSGTLSLRK VSSLASEELQSFRNAALGAPGLDKPQQEDLGLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQALMDAIRSGTGAARL

RK - UNI2144 - TPLVV
Transcript ENSMUST00000109651
Sequence
CTTCCGTCCTCTCGGCACGGCCGCTGTCCTCGCTAGCCCCGCGTGGGAGGACGATGGGTCAGCGCGGAAAAAGTGAATGAGGACGGCGGCGCCGCAGCCA

GCGCCCCAGTCGGCCGGCAGAGCAACCCGCCGGCTCCATGGACGCGCCGCGTGCACTGGCGGCCAAGCCCCCCACAGG - UNI15084 - - UNI159

50 - AAGGAAGATGAAGGCCCGTGCTCCGCCACCTCCTGGAAAGCCTGCTGCCCAGAATGTCCACAGCGAACAGAAACTGCCCCATGATGCCACCCTGG

GATCCCAGCAAAGCCTGGTCTACATGAAGGAGGCACTGCAGAACAGCACCTTGGACATCACCGTGGTTCTGCCCAGTGGACTGGAGAAGCAGAGTGTGGT

TAGTGGGAG - UNI15084 - - UNI15950 - - UNI23734 - CCACGCAATGATGGACCTACTGGTTGAACTCTGCCTTCAGAACCACCTGAA

TCCTTCTCACCACGTCCTAGAGATCTGGTCTTCTGAGACCCAACAGCCTTTGAGTTTTAAGCCAAATACGTTGATTGGGTCCTTGAATGTGCATACTGTA

CTTCTGAAAGAAAAAGTCCCTGAAGAAAGAGTTAAACCTGGCCTAACCAAGGCTCCTGAG - UNI23734 - AAATCTGTACGACTGGTAGTGAACTA

CCTGAGAACGCAGAAGGCTGTCGTGCGGGTGAGCCCTGAGGTGCCACTACAGAATATTCTGCCAGTCATCTGTGCGAAGTGTGAGGTCAACCCAGAACAC

GTGATTCTGCTCAGAGACAATGTTGCCGGGGAGGAGCTGGAGCTGTCCAAGTCCCTGAATGAACTAGGGATCAAGGAGCTGTATGCGTGGGACAACAGAA

GAG - UNI9800 - - UNI28225 - AAATGTTTAGAAAATCATCACTTGGCAATGATGAGACAGACAAAGAGAAGAAAAAGTTTCTGGGATTTTTC

AAAGCTAATAAAAGGAGCAACAGTAAG - UNI28225 - GCTGAGCATCTTGGGCTGTCAGGTGCAGATAGTGATGAGGACCCGGCGAAGTCAGCATC

TGGAGGGGACTTGAAC - UNI7131 - GGCTGCGTAACAACACCCAACTCACCATCCTTGCATTCTCGGTCCCTAACACTGGGTCCCTCCCTCTCCCT

GGGCAACATCTCTGGAGTGTCTATGAAGTCAGACATGAAGAAGCGCAGAGCCCCTCCTCCTCCAAGTCCCAAGCTGCTGGGTCAAGACAAGGTATCAGAA

AAG - UNI273 - GCCTCCCTCAGCTCACAGGCTGATCTCCAGAAGAAGAAGAGGCGGGCGCCAGCTCCTCCTCCACCACAGCAGCCACCACCAAGTC

CTGTGGTCCCCAACCGCAAGGAAGATAAGGAAGAGAACAGGAAGAGCACAGTGG - UNI273 - GTGTTGGACGTCAGGTGCCACAAAAGCCTCCCAG

AGGCACAGCTCGGGGCCCACCCCAGTTAGTGCTCCCCCCGCCCCCACCCTACCCTCCTCCTGACACAGATGTGACAGAGCCTGTCACCTTTCCTGGGGAA

GGCGCTGGTTCCGAGACCTCAGAGCTGAGACCCAAAC TGAGTCTGCCTCTGGGGCCTGGCAGCCACTGCAGCATGGGTGGAGTCTCTCAGGTGCCAGCG

GAGAGTGAGGAGACAGCATCTGAGGACACAACCGAGGACTCGGGGGTCATGAGCTCTCCCTCAGATGCCATCTCCCTGGACTCACAACAAGACAGCATGA

GATCCAAGGACAAATGGTCCACAGACCAGGAAGACGGCAGTGACCAGGACCTGGCTGGAACTCCAGAACTGGGTCCCCAAAAGAGCCCATCATGGGGGAA

AAGTGGTTCAGGAAGCTCAATTCTAAG GACTGAGAAAGCCACCATGCCTACCAATGATGATGAAGACCTATTCATCACTGGCCACTTACATCAGACCCT

GGCAGAACTTGATGAAGACCTGGAAG GAATGGAAGAAAATTATGAAACAGATACTAGCTCTCTAACCAACTCTGTCAATGGTGTATCCAACCACAGTCT

GCAAGAAGCCATAATCCCTGATAGTGGCGTGGATGACATCCCAGTCACTTTTATCGGGGAAGTTTCTGATGAGCCTTTTGACTCAGGGCTGTTCTCCAGT

AGATGTAACAATGCCACTACTTTTAACACGGGGAGCATTGCTAGCCAAAGATCTCATCTGTCCCCATCTCAGACTGAGCATAGCCAGCCATTCGTAAGGA

CAAGTAGAAAAGAGCCTGATCCCTCCCCTCCTTCCCAAGATAACAGGAAGAGAAATCAGCCAACCTTAGCCAACACATCTGAAAATGAGAATCCAGTTGA

AACAGACCCCACAGTTACATCACTTGTTTCAAAGCTTTTAATAGATGACCCAAAAGCAAAGGATAAAGGCAAAGTGCATGGTTCTAGTCACAGTGAGAAG

ACACAGGCAGGTCATGGAATAAACTCACTGCGAGTGAATCCAAGAGATGGTAAGGATGAGAGCTCCAATTCAGCACCCCCACCATGGTCTCATCATGGCC

AGGCCTTAGGGGGAAGCTATGGACTCAAGTATGGCCTCACGACATATAAAATTGTTCCTCCCAAATCAGAGATGAGGTGTTATGACAGGGATGTGTCCCT

CTCCACTGGTGCCATTAAGATTGATGAACTAGGGAATCTGGTGAGTCCTCACATGAACGGAAGCAGGACCATATCCCCACCATCAGCTGTTGTCGAAACA

GACACTCCACCTATTGGAAAAGTCAAAGAGTTCTGGAGGCGCAACTCAATGGAAAAGTACCTTAATGGGCCGGCTGAGTGCACTATCAAAAGGGCCCCCT

CCACCACTATCACTGCCACACCAGAAAAACCACAGCAAGATAATGGGATGAAGGCAGCCTTCACAGTGACCACTCCCCAGCAGCAGCCTGCCTCACAGGA

ATATGGGGCACACCTGGAGGAAGAGAGAAGCCGGCCACAGTCAGCAGTCTCTTGTTCTGTGAAAGTGCCAGCATCTAATCCCACAGACATCACATTCCTC

AAGCCTCAAAGAAGAACATCCAGCCAGTATGTGGCCTCTGCTATTGCCAAGAAGATGGGGCCTCCAAAAGTCCATGCTGATGTGGTGAGACCACATAAGG

CAACCACTGAACAGTGTCATGAAGAAGCAAAGCTGGCTAGATCTCCTCCCACCAGGAAAGATGATGCAGCTCCCAACCTACACTCAGAGGCAAGGCAGCA

TGAACATGGGACAAACCAGAGCTCTGTCTGCCTTCCCAGCAACCCTGGTGTGCAATTGCCAGCAGGAGGCCATCCCAAAGTAGAGGTCAACAGCACATAT

GGGAAGTCATCGACTCAAGACTATCCTGCTGCTGTCCACAGAAACTCCTATTTCCTCCCAGGCAGATCTTCCCATAGGGATCGTGTTTCTGTGGGACAGA

GCTGTGGTTTCAATGAAAAGCAAACTACAAGTAACCAAAAGGCAAATTCAACATCTAACTTCTCGCAGGCACTGGACAAGGCGCATCCACCCCCTCTGCT

CTTGGCAGAGGCCCGTGACTCTGGGAGGATACTGATGAATGGCTCTGCACGAACCCCAGGAAATTGTGAGCCCCCCCACTCTCCAAAAGAATCCACCCTG

ACTAGCTATATTATCTTACAGACAGAGGAAAAGCCCAGTTCGTTATCTACAGATGGTCAAGACGCAGATGATACTCTACCGTCCAGCATTTTTGGGCCAA

AGAAAAAGTTCAAGCCTGTCATTCAAAGGCCACTCCCAAAAGATGTATCCCTGCACAGTGCCCTGATGGAAGCTATCCACTCATCAGGAGGGAGAGAAAA

GCTCCGGAAG ACTGCAGAACAGACGTCAGAAGGAAGGCCAAAGAAACCATCCTACGTGGAGGCAGAGAGTGAGCGATCTGCCCTTCTGGCAGCCATTCG

GGGTCACAGTGGGACTCTCAGCCTCAGGAAG GTGTCATCCCTTGCCTCTGAGGAGCTCCAGAGCTTCCGCAATGCTGCACTCGGGGCTCCAGGTTTGGA

TAAACCTCAGCAAGAAGACCTTGGCCTTCCACCCCCACCTGCCCTGCCACCACCACCCGCTCCAGCCCCCCAGGCTCCTTCAGCCTCCGTAACAGTTTCT

AGGTTCAGCACCGGCACCCCCAGCAACTCAGTGAATGCTAGACAAGCCTTGATGGATGCCATCCGCTCGGGCACAGGAGCTGCAAGACTAAGAAAG - U

NI2144 - GTTCCCTTGCTCGTGTGAAGTCCTACCACTGAAGAGACCACCTGTACAGCTCCAAGTATCATCACTTTAGAAATCCACATGACAGGAAATG

AAACCTTCAAGAAGTGGCGGTACTTTCCTGTCTCCAGGCCAACTTGCCCACGGTGGATTTTCAGTGTTCCTACATAATGGTCAAAGAGGAGATACTGCTT

TGCTGTGTGACTTGTGTGCCAAGGACATATGATCTGCCTCTGAATGCTCACAGTTGCCAATAAACTGCTCTTGTTGGCAGAGTAATGGGAATACACAGGC

TGGAGCCCAGCACTCACACTTGATTTTAGCTATGGGCACAAGGAATTATGCCCTAAGTTGATTTTTGGATCTTTGAGACTTTGACCACATACACATGGTT

AAAATCACTTATGATCCTTTGAATTCTAGGTGTACAAAAACATAAATCAACAGAAATAGTCAGAATCTATTACATGCTCCAGGATGCTGCTTCTGGAGTA

AGAAGCACCATGGAGGAAGGCTGCTGAGATGACTTTTGCAGGATAAGAAAGCGTCAGATTCGTATTTGTATTCCTCACACAGTGAAGCCTCACACCTCAC

AGATGATCTTGGACTGTGATCTGACCAACTAGCTTTTAAAATTCCACTGTTGCTGCCCAGAATAGCAGCCCTACTTGACCCTCTGAGCAAGACATTCCTG

GCTCCTTAGAAGATGATGGGAAGCAGAGATGAGAACACTGGAAGGGTTGTCCGTTTTCTGTATAGATGTGTCCCACTTGTATAGTTTCCCCCCTCCCCCA

TCCCCAGTGTCCCAGAAGGCTATGACATGCATCAGGTTACTGTGAAGGAGCCTTGCATGGAGCCTGAGATTTCACCAGTAGCCTTCTGAAATCCTGCACA

GGGCCAGAGAGCAGAGTGTTGAGGACCTATATGTAGCAGAGGGCAGTCCACATTGTGCTGCACATTCTGTGGCTTACATTTTATCCTGACACACTTTGGC

ATGGTCCAGCAGCTGCCCTGGTATTATATGACATTCTTATAGTACATTGTGGGTAGACACCATCTTTAAAGAATTTAAACTCAGCAGGAAGTTTTGTGAT

TTTTTTTAATGTATCTCTAAAACCTTTTCTTATATGGAGAAAATCAAGACAGCAATATAAGTCAAAATGAGTTCATGATATAAAATCTCTGCCTTACTGA

AAAAAAAATGAAATCCTTTTACTATTTCCCCCTGTTTTAAATCTAGGCATCGGGTAGAGTGGGAACTTGGTATTGTGTGATTAACATTGCTAAACTTTCT

CAGTGAGGCAAGAGCTACCAGCCAATTGCTCTTAGTCACAGCTGTCTGCTCTTTCTCTTAGTGCCACAAATAAATGCAAATCCAATGCTGTAA
Translation
MDAPRALAAKPPTG - UNI15084 - - UNI15950 - GRKMKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSG

LEKQSVVSGS - UNI15084 - - UNI15950 - - UNI23734 - SHAMMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHT

VLLKEKVPEERVKPGLTKAPE - UNI23734 - KSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVAGEELELSKSLNELG

IKELYAWDNRRE - UNI9800 - - UNI28225 - EMFRKSSLGNDETDKEKKKFLGFFKANKRSNSK - UNI28225 - AEHLGLSGADSDEDP

AKSASGGDLN - UNI7131 - GCVTTPNSPSLHSRSLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEK - UNI273 - ASLSSQA

DLQKKKRRAPAPPPPQQPPPSPVVPNRKEDKEENRKSTVG - UNI273 - GVGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVTEPVTFPGEGAG

SETSELRPKL LSLPLGPGSHCSMGGVSQVPAESEETASEDTTEDSGVMSSPSDAISLDSQQDSMRSKDKWSTDQEDGSDQDLAGTPELGPQKSPSWGKS

GSGSSILR RTEKATMPTNDDEDLFITGHLHQTLAELDEDLEG GMEENYETDTSSLTNSVNGVSNHSLQEAIIPDSGVDDIPVTFIGEVSDEPFDSGLF

SSRCNNATTFNTGSIASQRSHLSPSQTEHSQPFVRTSRKEPDPSPPSQDNRKRNQPTLANTSENENPVETDPTVTSLVSKLLIDDPKAKDKGKVHGSSHS

EKTQAGHGINSLRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGLTTYKIVPPKSEMRCYDRDVSLSTGAIKIDELGNLVSPHMNGSRTISPPSAVV

ETDTPPIGKVKEFWRRNSMEKYLNGPAECTIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQEYGAHLEEERSRPQSAVSCSVKVPASNPTDIT

FLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKATTEQCHEEAKLARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPGVQLPAGGHPKVEVNS

TYGKSSTQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQKANSTSNFSQALDKAHPPPLLLAEARDSGRILMNGSARTPGNCEPPHSPKES

TLTSYIILQTEEKPSSLSTDGQDADDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGREKLRK TAEQTSEGRPKKPSYVEAESERSALLA

AIRGHSGTLSLRK VSSLASEELQSFRNAALGAPGLDKPQQEDLGLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQALMDAIRSGTGAARL

RK - UNI2144 - VPLLV
Transcript ENSMUST00000109650
Sequence
CTTCCGTCCTCTCGGCACGGCCGCTGTCCTCGCTAGCCCCGCGTGGGAGGACGATGGGTCAGCGCGGAAAAAGTGAATGAGGACGGCGGCGCCGCAGCCA

GCGCCCCAGTCGGCCGGCAGAGCAACCCGCCGGCTCCATGGACGCGCCGCGTGCACTGGCGGCCAAGCCCCCCACAGG - UNI15084 - - UNI159

50 - AAGGAAGATGAAGGCCCGTGCTCCGCCACCTCCTGGAAAGCCTGCTGCCCAGAATGTCCACAGCGAACAGAAACTGCCCCATGATGCCACCCTGG

GATCCCAGCAAAGCCTGGTCTACATGAAGGAGGCACTGCAGAACAGCACCTTGGACATCACCGTGGTTCTGCCCAGTGGACTGGAGAAGCAGAGTGTGGT

TAGTGGGAG - UNI15084 - - UNI15950 - - UNI23734 - CCACGCAATGATGGACCTACTGGTTGAACTCTGCCTTCAGAACCACCTGAA

TCCTTCTCACCACGTCCTAGAGATCTGGTCTTCTGAGACCCAACAGCCTTTGAGTTTTAAGCCAAATACGTTGATTGGGTCCTTGAATGTGCATACTGTA

CTTCTGAAAGAAAAAGTCCCTGAAGAAAGAGTTAAACCTGGCCTAACCAAGGCTCCTGAG - UNI23734 - AAATCTGTACGACTGGTAGTGAACTA

CCTGAGAACGCAGAAGGCTGTCGTGCGGGTGAGCCCTGAGGTGCCACTACAGAATATTCTGCCAGTCATCTGTGCGAAGTGTGAGGTCAACCCAGAACAC

GTGATTCTGCTCAGAGACAATGTTGCCGGGGAGGAGCTGGAGCTGTCCAAGTCCCTGAATGAACTAGGGATCAAGGAGCTGTATGCGTGGGACAACAGAA

GAG - UNI9800 - - UNI28225 - AAATGTTTAGAAAATCATCACTTGGCAATGATGAGACAGACAAAGAGAAGAAAAAGTTTCTGGGATTTTTC

AAAGCTAATAAAAGGAGCAACAGTAAG - UNI7131 - - UNI28225 - GGCTGCGTAACAACACCCAACTCACCATCCTTGCATTCTCGGTCCCT

AACACTGGGTCCCTCCCTCTCCCTGGGCAACATCTCTGGAGTGTCTATGAAGTCAGACATGAAGAAGCGCAGAGCCCCTCCTCCTCCAAGTCCCAAGCTG

CTGGGTCAAGACAAGGTATCAGAAAAG - UNI273 - GCCTCCCTCAGCTCACAGGCTGATCTCCAGAAGAAGAAGAGGCGGGCGCCAGCTCCTCCTC

CACCACAGCAGCCACCACCAAGTCCTGTGGTCCCCAACCGCAAGGAAGATAAGGAAGAGAACAGGAAGAGCACAGTGG - UNI273 - TGAGTCTGCC

TCTGGGGCCTGGCAGCCACTGCAGCATGGGTGGAGTCTCTCAGGTGCCAGCGGAGAGTGAGGAGACAGCATCTGAGGACACAACCGAGGACTCGGGGGTC

ATGAGCTCTCCCTCAGATGCCATCTCCCTGGACTCACAACAAGACAGCATGAGATCCAAGGACAAATGGTCCACAGACCAGGAAGACGGCAGTGACCAGG

ACCTGGCTGGAACTCCAGAACTGGGTCCCCAAAAGAGCCCATCATGGGGGAAAAGTGGTTCAGGAAGCTCAATTCTAAG GACTGAGAAAGCCACCATGC

CTACCAATGATGATGAAGACCTATTCATCACTGGCCACTTACATCAGACCCTGGCAGAACTTGATGAAGACCTGGAAG GAATGGAAGAAAATTATGAAA

CAGATACTAGCTCTCTAACCAACTCTGTCAATGGTGTATCCAACCACAGTCTGCAAGAAGCCATAATCCCTGATAGTGGCGTGGATGACATCCCAGTCAC

TTTTATCGGGGAAGTTTCTGATGAGCCTTTTGACTCAGGGCTGTTCTCCAGTAGATGTAACAATGCCACTACTTTTAACACGGGGAGCATTGCTAGCCAA

AGATCTCATCTGTCCCCATCTCAGACTGAGCATAGCCAGCCATTCGTAAGGACAAGTAGAAAAGAGCCTGATCCCTCCCCTCCTTCCCAAGATAACAGGA

AGAGAAATCAGCCAACCTTAGCCAACACATCTGAAAATGAGAATCCAGTTGAAACAGACCCCACAGTTACATCACTTGTTTCAAAGCTTTTAATAGATGA

CCCAAAAGCAAAGGATAAAGGCAAAGTGCATGGTTCTAGTCACAGTGAGAAGACACAGGCAGGTCATGGAATAAACTCACTGCGAGTGAATCCAAGAGAT

GGTAAGGATGAGAGCTCCAATTCAGCACCCCCACCATGGTCTCATCATGGCCAGGCCTTAGGGGGAAGCTATGGACTCAAGTATGGCCTCACGACATATA

AAATTGTTCCTCCCAAATCAGAGATGAGGTGTTATGACAGGGATGTGTCCCTCTCCACTGGTGCCATTAAGATTGATGAACTAGGGAATCTGGTGAGTCC

TCACATGAACGGAAGCAGGACCATATCCCCACCATCAGCTGTTGTCGAAACAGACACTCCACCTATTGGAAAAGTCAAAGAGTTCTGGAGGCGCAACTCA

ATGGAAAAGTACCTTAATGGGCCGGCTGAGTGCACTATCAAAAGGGCCCCCTCCACCACTATCACTGCCACACCAGAAAAACCACAGCAAGATAATGGGA

TGAAGGCAGCCTTCACAGTGACCACTCCCCAGCAGCAGCCTGCCTCACAGGAATATGGGGCACACCTGGAGGAAGAGAGAAGCCGGCCACAGTCAGCAGT

CTCTTGTTCTGTGAAAGTGCCAGCATCTAATCCCACAGACATCACATTCCTCAAGCCTCAAAGAAGAACATCCAGCCAGTATGTGGCCTCTGCTATTGCC

AAGAAGATGGGGCCTCCAAAAGTCCATGCTGATGTGGTGAGACCACATAAGGCAACCACTGAACAGTGTCATGAAGAAGCAAAGCTGGCTAGATCTCCTC

CCACCAGGAAAGATGATGCAGCTCCCAACCTACACTCAGAGGCAAGGCAGCATGAACATGGGACAAACCAGAGCTCTGTCTGCCTTCCCAGCAACCCTGG

TGTGCAATTGCCAGCAGGAGGCCATCCCAAAGTAGAGGTCAACAGCACATATGGGAAGTCATCGACTCAAGACTATCCTGCTGCTGTCCACAGAAACTCC

TATTTCCTCCCAGGCAGATCTTCCCATAGGGATCGTGTTTCTGTGGGACAGAGCTGTGGTTTCAATGAAAAGCAAACTACAAGTAACCAAAAGGCAAATT

CAACATCTAACTTCTCGCAGGCACTGGACAAGGCGCATCCACCCCCTCTGCTCTTGGCAGAGGCCCGTGACTCTGGGAGGATACTGATGAATGGCTCTGC

ACGAACCCCAGGAAATTGTGAGCCCCCCCACTCTCCAAAAGAATCCACCCTGACTAGCTATATTATCTTACAGACAGAGGAAAAGCCCAGTTCGTTATCT

ACAGATGGTCAAGACGCAGATGATACTCTACCGTCCAGCATTTTTGGGCCAAAGAAAAAGTTCAAGCCTGTCATTCAAAGGCCACTCCCAAAAGATGTAT

CCCTGCACAGTGCCCTGATGGAAGCTATCCACTCATCAGGAGGGAGAGAAAAGCTCCGGAAG ACTGCAGAACAGACGTCAGAAGGAAGGCCAAAGAAAC

CATCCTACGTGGAGGCAGAGAGTGAGCGATCTGCCCTTCTGGCAGCCATTCGGGGTCACAGTGGGACTCTCAGCCTCAGGAAG GTGTCATCCCTTGCCT

CTGAGGAGCTCCAGAGCTTCCGCAATGCTGCACTCGGGGCTCCAGGTTTGGATAAACCTCAGCAAGAAGACCTTGGCCTTCCACCCCCACCTGCCCTGCC

ACCACCACCCGCTCCAGCCCCCCAGGCTCCTTCAGCCTCCGTAACAGTTTCTAGGTTCAGCACCGGCACCCCCAGCAACTCAGTGAATGCTAGACAAGCC

TTGATGGATGCCATCCGCTCGGGCACAGGAGCTGCAAGACTAAGAAAG - UNI2144 - GTTCCCTTGCTCGTGTGAAGTCCTACCACTGAAGAGACC

ACCTGTACAGCTCCAAGTATCATCACTTTAGAAATCCACATGACAGGAAATGAAACCTTCAAGAAGTGGCGGTACTTTCCTGTCTCCAGGCCAACTTGCC

CACGGTGGATTTTCAGTGTTCCTACATAATGGTCAAAGAGGAGATACTGCTTTGCTGTGTGACTTGTGTGCCAAGGACATATGATCTGCCTCTGAATGCT

CACAGTTGCCAATAAACTGCTCTTGTTGGCAGAGTAATGGGAATACACAGGCTGGAGCCCAGCACTCACACTTGATTTTAGCTATGGGCACAAGGAATTA

TGCCCTAAGTTGATTTTTGGATCTTTGAGACTTTGACCACATACACATGGTTAAAATCACTTATGATCCTTTGAATTCTAGGTGTACAAAAACATAAATC

AACAGAAATAGTCAGAATCTATTACATGCTCCAGGATGCTGCTTCTGGAGTAAGAAGCACCATGGAGGAAGGCTGCTGAGATGACTTTTGCAGGATAAGA

AAGCGTCAGATTCGTATTTGTATTCCTCACACAGTGAAGCCTCACACCTCACAGATGATCTTGGACTGTGATCTGACCAACTAGCTTTTAAAATTCCACT

GTTGCTGCCCAGAATAGCAGCCCTACTTGACCCTCTGAGCAAGACATTCCTGGCTCCTTAGAAGATGATGGGAAGCAGAGATGAGAACACTGGAAGGGTT

GTCCGTTTTCTGTATAGATGTGTCCCACTTGTATAGTTTCCCCCCTCCCCCATCCCCAGTGTCCCAGAAGGCTATGACATGCATCAGGTTACTGTGAAGG

AGCCTTGCATGGAGCCTGAGATTTCACCAGTAGCCTTCTGAAATCCTGCACAGGGCCAGAGAGCAGAGTGTTGAGGACCTATATGTAGCAGAGGGCAGTC

CACATTGTGCTGCACATTCTGTGGCTTACATTTTATCCTGACACACTTTGGCATGGTCCAGCAGCTGCCCTGGTATTATATGACATTCTTATAGTACATT

GTGGGTAGACACCATCTTTAAAGAATTTAAACTCAGCAGGAAGTTTTGTGATTTTTTTTAATGTATCTCTAAAACCTTTTCTTATATGGAGAAAATCAAG

ACAGCAATATAAGTCAAAATGAGTTCATGATATAAAATCTCTGCCTTACTGAAAAAAAAATGAAATCCTTTTACTATTTCCCCCTGTTTTAAATCTAGGC

ATCGGGTAGAGTGGGAACTTGGTATTGTGTGATTAACATTGCTAAACTTTCTCAGTGAGGCAAGAGCTACCAGCCAATTGCTCTTAGTCACAGCTGTCTG

CTCTTTCTCTTAGTGCCACAAATAAATGCAAATCCAATGCTGTAA
Translation
MDAPRALAAKPPTG - UNI15084 - - UNI15950 - GRKMKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSG

LEKQSVVSGS - UNI15084 - - UNI15950 - - UNI23734 - SHAMMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHT

VLLKEKVPEERVKPGLTKAPE - UNI23734 - KSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVAGEELELSKSLNELG

IKELYAWDNRRE - UNI9800 - - UNI28225 - EMFRKSSLGNDETDKEKKKFLGFFKANKRSNSK - UNI7131 - - UNI28225 - GCV

TTPNSPSLHSRSLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEK - UNI273 - ASLSSQADLQKKKRRAPAPPPPQQPPPSPVVPN

RKEDKEENRKSTVV - UNI273 - VSLPLGPGSHCSMGGVSQVPAESEETASEDTTEDSGVMSSPSDAISLDSQQDSMRSKDKWSTDQEDGSDQDLAG

TPELGPQKSPSWGKSGSGSSILR RTEKATMPTNDDEDLFITGHLHQTLAELDEDLEG GMEENYETDTSSLTNSVNGVSNHSLQEAIIPDSGVDDIPVT

FIGEVSDEPFDSGLFSSRCNNATTFNTGSIASQRSHLSPSQTEHSQPFVRTSRKEPDPSPPSQDNRKRNQPTLANTSENENPVETDPTVTSLVSKLLIDD

PKAKDKGKVHGSSHSEKTQAGHGINSLRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGLTTYKIVPPKSEMRCYDRDVSLSTGAIKIDELGNLVSP

HMNGSRTISPPSAVVETDTPPIGKVKEFWRRNSMEKYLNGPAECTIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQEYGAHLEEERSRPQSAV

SCSVKVPASNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKATTEQCHEEAKLARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPG

VQLPAGGHPKVEVNSTYGKSSTQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQKANSTSNFSQALDKAHPPPLLLAEARDSGRILMNGSA

RTPGNCEPPHSPKESTLTSYIILQTEEKPSSLSTDGQDADDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGREKLRK TAEQTSEGRPKK

PSYVEAESERSALLAAIRGHSGTLSLRK VSSLASEELQSFRNAALGAPGLDKPQQEDLGLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQ

ALMDAIRSGTGAARLRK - UNI2144 - VPLLV

For any suggestions or comments, please send an email to unitrap@crg.es