Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020176 (Grb10)
Chromosomal location
Chr 11: 11830511 - 11937404 (-)
Description
growth factor receptor bound protein 10 Gene [Source:MGI (curated);Acc:Grb10-005]
RefSeq_dna
NM_010345 
RefSeq_peptide
NP_034475.2 
MGI
MGI:103232 
Uniprot/SWISSPROT
Q60760 
Uniprot/SPTREMBL
B1ATS7 B1ATS8 Q5SUW0 Q5SUW3 Q80Z28 Q3TFU9 Q3TQ71 
Human Ortholog
ENSG00000106070 (GRB10)
Omim not available
UniTrap UNI6970
Vector Insertion
Chr 11: 11927975 - 11937194
Public Clones KST268 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30999
Vector Insertion
Chr 11: 11870425 - 11887678
Public Clones IST10987C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33313
Vector Insertion
Chr 11: 11857754 - 11867689
Public Clones (sanger) IST10456F4 (tigm) IST11834H6 (tigm) IST12505F5 (tigm) IST13119B6 (tigm)
IST10701B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2746
Vector Insertion
Chr 11: 11854912 - 11857754
Public Clones AK0255 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10095
Vector Insertion
Chr 11: 11846806 - 11851505
Public Clones XC302 (baygenomics) (cmhd) IST12652C11 (tigm) IST12908A3 (tigm) IST10783H5 (tigm)
IST14876C6 (tigm) IST10854E3 (tigm) IST12908A2 (tigm) IST15062E9 (tigm)
IST11753F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29422
Vector Insertion
Chr 11: 11846036 - 11846689
Public Clones CMHD-GT_426A7-3 (cmhd) IST10683G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29790
Vector Insertion
Chr 11: 11838412 - 11843984
Public Clones E068A08 (ggtc) (ggtc) CMHD-GT_519B12-5S (cmhd) CMHD-GT_410F8-3 (cmhd)
IST13322B4 (tigm) IST13274A1 (tigm) IST13327D1 (tigm) IST13247C3 (tigm)
IST13405E9 (tigm) IST13440C3 (tigm) IST12803B4 (tigm) IST13622D5 (tigm)
IST13340F12 (tigm) IST13982D4 (tigm) IST13255H7 (tigm) IST13200C12 (tigm)
IST12550D11 (tigm) IST13271A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37184
Vector Insertion
Chr 11: 11837927 - 11838412
Public Clones CMHD-GT_504F1-3 (cmhd) CMHD-GT_453F9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29283
Vector Insertion
Chr 11: 11836809 - 11837003
Public Clones not available
Private Clones OST816 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109653
Sequence
AGCATGGTCTTGGGCTTCAAGTACTAATGAACAACGATATTAACTCGTCCGTGGAAAGCCTTAACTCAGCTTGCAACATGCAGTCTGATACTGATACTGC

ACCACTTCTTGAGGATGGCCAGCATGCCAGCAACCAGGGAGCAGCATCTAGCTCCCGGGGACAGCCACAGGCGTCCCCGAGGCAGAAAATGCAACGCTCG

CAGCCTGTGCACATTCTCAG - UNI30999 - - UNI33313 - GCGCCTTCAGGAGGAAGACCAGCAGTTAAGAACTGCATCTCTTCCGGCCATCC

CCAACCCATTTCCGGAGCTCACTGGTGCGGCCCCTGGGAGCCCTCCTTCGGTTGCTCCTAGCTCCTTACCTCCTCCTCCGAGCCAGCCACCTGCCAAGCA

T - UNI2746 - - UNI33313 - TTCCCTCCAGGCTTTCAGCTGTCGAAACTCACCCGTCCAGGTCTGTGGACAAAGACCACTGCGAGATTTTCAA

AGAAACAACCTAAGAACCAGTGTCCAACCGACACTGTGAATCCAGTGGCACGGATGCCCACTTCACAGATGGAGAAGCTGAGGCTCAGAAAG GATGTCA

AAGTCTTTAGTGAAGATGGGACCAGCAAAGTGGTGGAGATTCTAACCGACATGACAGCCAGGGACCTGTGCCAGCTGCTGGTTTACAAAAGTCACTGTGT

GGATGACAACAGCTGGACTCTGGTGGAACACCACCCACAACTGGGATTAG - UNI10095 - AGAGGTGCCTGGAGGACCATGAGATCGTGGTCCAAG

TGGAGAGTACCATGCCAAGTGAGAGCAAATTCTTATTCAGAAAGAATTATGCGAAGTACGAGTTCTTTAAGAATCCAGTG - UNI29422 - AACTTC

TTCCCGGATCAGATGGTCAATTGGTGCCAGCAGTCCAACGGTGGCCAGGCGCAGCTTCTGCAG GAACCCAGACACCTGCAGCTGCTGGCTGACCTGGAA

GAAAGCAGCATCTTCTACCTGATTGCTGGAAAGAAGCAGTACAACGCGCCGAATGAACATGGGATGTGCATCAAG - UNI29790 - CCAAACAAAGC

GAAGACCGAGATGAAGGAGCTTCGTCTGCTCTGTGCCGAAGATGAGCAGATCCGTACTTGCTGGATGACTGCCTTCAGACTGCTCAAG - UNI29790 

- TACGGAATGCTCCTGTACCAAAACTATCGCATCCCACAGAGGAAGGGTCTGCCCCCTCCTTTCAACGCACCTATG - UNI29790 - CGCAGTGTT

TCTGAGAATTCTCTTGTGGCCATGGATTTTTCTGGACAAATCGGAAGAGTGATCGATAACCCGGCTGAAGCCCAGAGTGCTGCCCTGGAAGAGGGCCATG

CCTGGCGT AAGCGGAGCACACGGATGAATATCCTAAGCAGCCAAAGCCCACTGCATCCTTCTACCCTGAATGCAG - UNI29283 - TGATTCACAG

GACTCAGCATTGGTTCCATGGACGTATCTCCCGCGAGGAGTCTCACAGGATCATCAAGCAACAAGGTCTCGTGGACGG GCTGTTCCTCCTTCGTGACAG

CCAGAGTAATCCAAAGGCGTTCGTACTGACACTGTGCCATCACCAGAAGATTAAAAACTTCCAGATCTTACCT TGCGAGGATGATGGGCAGACCTTCTT

CACTCTGGATGATGGGAACACCAAGTTCTCCGATCTGATCCAGCTGGTCGACTTCTACCAGCTCAACAAAGGTGTTCTGCCCTGCAAGCTGAAACACCAC

TGCATCCGCGTGGCCTTATGACCTCCTTGCCCACTCACAGAGGCTGGAGGCAGCGACACTGGAACGGAGAAGAGAGATCTGCATGAGGGTGAGAACACAC

ACCTACTCCCACCCAAGGACTCAGAACAACATGGCTTTTTGATCGGTACCAACCGACCTACATCAATTAGTTATTGGACTTCACAAAGATTTGCCGCTGT

GGATCAAACAGGACCACCTCCCTCTGCGTCAGCCATTTAAAATTGGGGGAGGGAAGAGATCCAGTGCAAGTGTGGGAAGAAACTGGAATGACGATTTTGA

TTAGGCCACGTAGGGTGAAAACCGCAGAAAAATGATTGGAAATGAACTCTTGCCCTGGAATAACCTTGACAATTCAAACCGCGATGTTTA
Translation
MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQPVHILR - UNI30999 - - UNI33313 - RRLQEEDQ

QLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKH - UNI2746 - - UNI33313 - FPPGFQLSKLTRPGLWTKTTARFSKKQPKN

QCPTDTVNPVARMPTSQMEKLRLRK DVKVFSEDGTSKVVEILTDMTARDLCQLLVYKSHCVDDNSWTLVEHHPQLGLE - UNI10095 - ERCLEDH

EIVVQVESTMPSESKFLFRKNYAKYEFFKNPV - UNI29422 - NFFPDQMVNWCQQSNGGQAQLLQ EPRHLQLLADLEESSIFYLIAGKKQYNAPN

EHGMCIK - UNI29790 - PNKAKTEMKELRLLCAEDEQIRTCWMTAFRLLK - UNI29790 - YGMLLYQNYRIPQRKGLPPPFNAPM - UNI2

9790 - RSVSENSLVAMDFSGQIGRVIDNPAEAQSAALEEGHAWR KRSTRMNILSSQSPLHPSTLNAV - UNI29283 - VIHRTQHWFHGRISRE

ESHRIIKQQGLVDG GLFLLRDSQSNPKAFVLTLCHHQKIKNFQILP CEDDGQTFFTLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Transcript ENSMUST00000109654
Sequence
ATCGCCATCTACAGTTTCTGTCTGTTAGAGGAGAGTGTGAAATCTACTGCGTCCTAGCTCTGTACCTTG - UNI30999 - GACAAAGTGGGGCAGTC

AACGTCCAAACCCGAAAACCTAGCTAAGTCTGGGTTTTCGCCACAACAAAGAAGCCAACCAG - UNI30999 - AGCATGGTCTTGGGCTTCAAGTAC

TAATGAACAACGATATTAACTCGTCCGTGGAAAGCCTTAACTCAGCTTGCAACATGCAGTCTGATACTGATACTGCACCACTTCTTGAGGATGGCCAGCA

TGCCAGCAACCAGGGAGCAGCATCTAGCTCCCGGGGACAGCCACAGGCGTCCCCGAGGCAGAAAATGCAACGCTCGCAGCCTGTGCACATTCTCAG - U

NI30999 - - UNI33313 - GCGCCTTCAGGAGGAAGACCAGCAGTTAAGAACTGCATCTCTTCCGGCCATCCCCAACCCATTTCCGGAGCTCACTG

GTGCGGCCCCTGGGAGCCCTCCTTCGGTTGCTCCTAGCTCCTTACCTCCTCCTCCGAGCCAGCCACCTGCCAAGCAT - UNI2746 - - UNI33313

 - GATGTCAAAGTCTTTAGTGAAGATGGGACCAGCAAAGTGGTGGAGATTCTAACCGACATGACAGCCAGGGACCTGTGCCAGCTGCTGGTTTACAAAA

GTCACTGTGTGGATGACAACAGCTGGACTCTGGTGGAACACCACCCACAACTGGGATTAG - UNI10095 - AGAGGTGCCTGGAGGACCATGAGATC

GTGGTCCAAGTGGAGAGTACCATGCCAAGTGAGAGCAAATTCTTATTCAGAAAGAATTATGCGAAGTACGAGTTCTTTAAGAATCCAGTG - UNI2942

2 - AACTTCTTCCCGGATCAGATGGTCAATTGGTGCCAGCAGTCCAACGGTGGCCAGGCGCAGCTTCTGCAG AATTTTCTGAACACCAGCAGCTGCCC

TGAGATCCAGGGGTTCTTGCAGGTGAAAGAGGTAGGACGCAAGTCTTGGAAGAAGCTGTATGTGTGCCTGCGCAGATCTGGCCTCTATTACTCCACCAAG

GGGACTTCAAAA GAACCCAGACACCTGCAGCTGCTGGCTGACCTGGAAGAAAGCAGCATCTTCTACCTGATTGCTGGAAAGAAGCAGTACAACGCGCCG

AATGAACATGGGATGTGCATCAAG - UNI29790 - CCAAACAAAGCGAAGACCGAGATGAAGGAGCTTCGTCTGCTCTGTGCCGAAGATGAGCAGAT

CCGTACTTGCTGGATGACTGCCTTCAGACTGCTCAAG - UNI29790 - TACGGAATGCTCCTGTACCAAAACTATCGCATCCCACAGAGGAAGGGTC

TGCCCCCTCCTTTCAACGCACCTATG - UNI29790 - CGCAGTGTTTCTGAGAATTCTCTTGTGGCCATGGATTTTTCTGGACAAATCGGAAGAGTG

ATCGATAACCCGGCTGAAGCCCAGAGTGCTGCCCTGGAAGAGGGCCATGCCTGGCGT AAGCGGAGCACACGGATGAATATCCTAAGCAGCCAAAGCCCA

CTGCATCCTTCTACCCTGAATGCAG - UNI29283 - TGATTCACAGGACTCAGCATTGGTTCCATGGACGTATCTCCCGCGAGGAGTCTCACAGGAT

CATCAAGCAACAAGGTCTCGTGGACGG GCTGTTCCTCCTTCGTGACAGCCAGAGTAATCCAAAGGCGTTCGTACTGACACTGTGCCATCACCAGAAGAT

TAAAAACTTCCAGATCTTACCT TGCGAGGATGATGGGCAGACCTTCTTCACTCTGGATGATGGGAACACCAAGTTCTCCGATCTGATCCAGCTGGTCGA

CTTCTACCAGCTCAACAAAGGTGTTCTGCCCTGCAAGCTGAAACACCACTGCATCCGCGTGGCCTTATGACCTCCTTGCCCACTCACAGAGGCTGGAGGC

AGCGACACTGGAACGGAGAAGAGAGATCTGCATGAGGGTGAGAACACACACCTACTCCCACCCAAGGACTCAGAACAACATGGCTTTTTGATCGGTACCA

ACCGACCTACATCAATTAGTTATTGGACTTCACAAAGATTTGCCGCTGTGGATCAAACAGGACCACCTCCCTCTGCGTCAGCCATTTAAAATTGGGGGAG

GGAAGAGATCCAGTGCAAGTGTGGGAAGAAACTGGAATGACGATTTTGATTAGGCCACGTAGGGTGAAAACCGCAGAAAAATGATTGGAAATGAACTCTT

GCCCTGGAATAACCTTGACAATTCAAACCGCGATGTTTACTTTTTGTATTGATCACTTTTTTGCACTCCTTCTTCGTTGTCGATGTTGTACTCAGCCTAT

GGTAGGAGAGGATGTGGCTTTGCAACTCAGATCAGACAAAGAATTTTTGAATTGGCAGGCTTTAGCCTACAAATGGGTCCCCCAAGTTTTCTAGATAACA

TCCTGCTCTCTGCAGGTTGCGGCAGTGTGGGTTTGGCTCCAGTCCTTCCCATTATACTTGAAAAGCTTTTTTTTTTTTTTTAAATAAAATAATAAGATAA

AAGGTGACAACCGCAGTTGACACCTAGCATGTTTTGTGGACGCAGTCAAGCTGCCACAGTCTGGTCATCGTTGTTGTTGTGCTGACGTCTGGTCATGTAT

TATTAGTGTGTCTCGTTCTCCACGGTGCTGGAGACCTCATTACTTTGGAAAACTCACTGTTCCCCAGCACAGCACAGCTGCATGACCTCAGCTTCAGACT

GATGTCAGCCAGCCTTCTTGGAACACATTGCTATTCATTGTGGATGCCACACAGTCCATCTGGGGTGCCCTGTGCCTCCCATTTTCACAGCCGCCCACTG

TTGTAGAATAATCGCTGCCTTTACCCTCTGCAGTACCCTCAGTCATTTCACTTCTCCCACAGGGGTGGGGTAGGGGTGGGGTTAAAGGATCGAAAGAGAA

AAAAACGCCAACTTGTTGGCCTTGTGCTCTGTCACTCTGAGCATCTATGGTGATAAAGAGAAGGAAACGCTGCAGAGGCACAAGCATAAGCTGGCTTTGA

GTCTTTGAAAGCTTGATGGCCTCTGCACCCTACTGAAAACCCCCTAAGCCAGCAGGAGCAGGGTATGCAGAGGCTTTGCCTCTGCTGGCTTAGGGTGAGA

AGTACCTCACAATGGATGTGAACATTGGACAGATTTTAGGAGCATGATGTTTGCCTCCTCCGAGAGAGAGGAGTCAGAGAGAGAGAGGAGTCAGAAGGTG

GCCGGAGTTATCATTGGGTCCCCTGAGCTCCATGAAGGACCCTCTGTTGTCCCCTTGATGATTTATCAGGCATGAGAGTAGCAGACAGGATTGCCTTGAG

AAACACACAGACAACAACGGTGGTGAACACATTTCCCTTTCTTGATACCACCCAGAAAGTCTGCTACATACCTGAGTTAGCCACTAGATTGCCTGTCCCG

ACTCATTGAAGTGCTCCCCAGGGAGCCACTTCTGATTTGCCATGGTTGACAGCATAGTGGAAGATAGATATGACAGCGCTTTGTAAAGCAGGCCAGTGGC

AAGCTGGCCCACAGTAGAGAAACACTGTAGTTCACAGACCATGCAACCGTGTTTCCACGAGATGTTATTACAACAAATGAAGAATTTTTTTCCTTTTTTT

TCATTTTAATCTTTTTTGACTTTTTTTTAGTTAACCATTTTTTATGCATAAGTGCTCAAATGCATTTCTCTTTCTTTCGAAACTAGTTAATCGTTAAGTT

GACAATGAGAGAATTCTCAAGTTCATACCTGGCAGCAGGCTCCCACTGATCTTCCCCTTACAGACAGATAACAGACATTTCAGTTTTACCGTGCTCATTT

CTTTTTGCTGACTTAAGGTCAGAACTTTTACAGACAACAAACAACCCTAGGGTTTCTTTTTCCAGTTTACACAGACCGGTCCCCACAGTGCAGAATCCAT

TTCTCTTTCGTCTCAACAGTAGACAACTAGGATGTGGATCTCATATTTATAAGTATGCATTTTATTTAAGAGGAAGTATAGGCTTGACTCTGGTTCACAA

TTTCGTACGTAGCTGGTTTGACGTAGAACTTTGTACTTCCCTTGCCGAAGTGAATTGTTGAAGGCTGCAACCCACCCACCTTGAGTGTAGCAGACTTCAG

TGGCCCCGAGATCGCCAGCCCTTTGCACAGGCAGCTGGGAATTCCACCTGAAACAGCTGGTCCCTAGGTTAGCGGGTTCCCAGCCCCCCTAATCAGAGAC

TGAAGGACAATTGACTTTTATTTTTGTATTTAATTGACATGAATGTAAAGGGGACAGCTCAGGGTTGTTTTGGAGCCTGTTTGACTTTGTAATCTCTGCC

TGTGATTTTCTTTTCTAAATGACGACTCCGTGTAACCACCTGGACTAAGTTGAGAAGGAAACTGCCAAATGCTTTGGGTTTTTAGGGTTTTAATAGGTAG

ACTCTGTTCTATTATTAGGTGTTAAGAGTTTCCAAACGTGTTTTCTTTTTTCTTTTATTGTTTGCTTAAACTTTGAAGAAATATGTGCCTCAGCTTAGAT

GTTTTGTCTTCCCCTTTCTGCACTTAAATACCTGACAGCCTGTTCGATCGCTGTGCCTCCGAGGGCGCTTCTAGCTCATCGTAGATTTGTGATGTCATAG

TGCAAACTGCAGTGACCGGTAAAATGACCTGACATGTAACCGTTTTCAGGGAATGCAGAGGGTGTTAACTAATAGACAAAACCTTTATCCCGCGTGCTTT

GCTTCACCTTGTGCTATATAGCTCTTTGGCTCGTGAACCTAATTGTAAACTTTCAGGTATTTTTGTACAAATAAGGGACTGATGTTCTGTTTCTTGTTAT

TAGAAATAAACATTAATAAAGCGTT
Translation
 - UNI30999 -  - UNI30999 - MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQPVHILR - UNI3

0999 - - UNI33313 - RRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKH - UNI2746 - - UNI33313 - DV

KVFSEDGTSKVVEILTDMTARDLCQLLVYKSHCVDDNSWTLVEHHPQLGLE - UNI10095 - ERCLEDHEIVVQVESTMPSESKFLFRKNYAKYEFF

KNPV - UNI29422 - NFFPDQMVNWCQQSNGGQAQLLQ NFLNTSSCPEIQGFLQVKEVGRKSWKKLYVCLRRSGLYYSTKGTSK EPRHLQLLADL

EESSIFYLIAGKKQYNAPNEHGMCIK - UNI29790 - PNKAKTEMKELRLLCAEDEQIRTCWMTAFRLLK - UNI29790 - YGMLLYQNYRIPQ

RKGLPPPFNAPM - UNI29790 - RSVSENSLVAMDFSGQIGRVIDNPAEAQSAALEEGHAWR KRSTRMNILSSQSPLHPSTLNAV - UNI29283

 - VIHRTQHWFHGRISREESHRIIKQQGLVDG GLFLLRDSQSNPKAFVLTLCHHQKIKNFQILP CEDDGQTFFTLDDGNTKFSDLIQLVDFYQLNKG

VLPCKLKHHCIRVAL
Transcript ENSMUST00000109656
Sequence
GGGAGGCGGCAGGAAGGGAAGGGCGCTGCGACCAGTGGCGGGCGGGATTCGCGTTCCGAGACCCACGGGAGCACGAAGTTTCCGCGCACCGTCTCACGCA

CGGCGACTGGGACCGTCCAGTGTCCGGCTTTGCCTTCGGTTTTTCTCCGTTGTGACTCGTGCAACGTGTGGCCAGCGGCCACGCGGAGGCGACGAGGAGC

TGCACGTCAG - UNI6970 - - UNI30999 - GACAAAGTGGGGCAGTCAACGTCCAAACCCGAAAACCTAGCTAAGTCTGGGTTTTCGCCACAAC

AAAGAAGCCAACCAG - UNI30999 - AGCATGGTCTTGGGCTTCAAGTACTAATGAACAACGATATTAACTCGTCCGTGGAAAGCCTTAACTCAGCT

TGCAACATGCAGTCTGATACTGATACTGCACCACTTCTTGAGGATGGCCAGCATGCCAGCAACCAGGGAGCAGCATCTAGCTCCCGGGGACAGCCACAGG

CGTCCCCGAGGCAGAAAATGCAACGCTCGCAGCCTGTGCACATTCTCAG - UNI30999 - - UNI33313 - GCGCCTTCAGGAGGAAGACCAGCA

GTTAAGAACTGCATCTCTTCCGGCCATCCCCAACCCATTTCCGGAGCTCACTGGTGCGGCCCCTGGGAGCCCTCCTTCGGTTGCTCCTAGCTCCTTACCT

CCTCCTCCGAGCCAGCCACCTGCCAAGCAT - UNI2746 - - UNI33313 - GATGTCAAAGTCTTTAGTGAAGATGGGACCAGCAAAGTGGTGGA

GATTCTAACCGACATGACAGCCAGGGACCTGTGCCAGCTGCTGGTTTACAAAAGTCACTGTGTGGATGACAACAGCTGGACTCTGGTGGAACACCACCCA

CAACTGGGATTAG - UNI10095 - AGAGGTGCCTGGAGGACCATGAGATCGTGGTCCAAGTGGAGAGTACCATGCCAAGTGAGAGCAAATTCTTATT

CAGAAAGAATTATGCGAAGTACGAGTTCTTTAAGAATCCAGTG - UNI29422 - AACTTCTTCCCGGATCAGATGGTCAATTGGTGCCAGCAGTCCA

ACGGTGGCCAGGCGCAGCTTCTGCAG AATTTTCTGAACACCAGCAGCTGCCCTGAGATCCAGGGGTTCTTGCAGGTGAAAGAGGTAGGACGCAAGTCTT

GGAAGAAGCTGTATGTGTGCCTGCGCAGATCTGGCCTCTATTACTCCACCAAGGGGACTTCAAAA GAACCCAGACACCTGCAGCTGCTGGCTGACCTGG

AAGAAAGCAGCATCTTCTACCTGATTGCTGGAAAGAAGCAGTACAACGCGCCGAATGAACATGGGATGTGCATCAAG - UNI29790 - CCAAACAAA

GCGAAGACCGAGATGAAGGAGCTTCGTCTGCTCTGTGCCGAAGATGAGCAGATCCGTACTTGCTGGATGACTGCCTTCAGACTGCTCAAG - UNI2979

0 - TACGGAATGCTCCTGTACCAAAACTATCGCATCCCACAGAGGAAGGGTCTGCCCCCTCCTTTCAACGCACCTATG - UNI29790 - CGCAGTG

TTTCTGAGAATTCTCTTGTGGCCATGGATTTTTCTGGACAAATCGGAAGAGTGATCGATAACCCGGCTGAAGCCCAGAGTGCTGCCCTGGAAGAGGGCCA

TGCCTGGCGT AAGCGGAGCACACGGATGAATATCCTAAGCAGCCAAAGCCCACTGCATCCTTCTACCCTGAATGCAG - UNI29283 - TGATTCAC

AGGACTCAGCATTGGTTCCATGGACGTATCTCCCGCGAGGAGTCTCACAGGATCATCAAGCAACAAGGTCTCGTGGACGG GCTGTTCCTCCTTCGTGAC

AGCCAGAGTAATCCAAAGGCGTTCGTACTGACACTGTGCCATCACCAGAAGATTAAAAACTTCCAGATCTTACCT TGCGAGGATGATGGGCAGACCTTC

TTCACTCTGGATGATGGGAACACCAAGTTCTCCGATCTGATCCAGCTGGTCGACTTCTACCAGCTCAACAAAGGTGTTCTGCCCTGCAAGCTGAAACACC

ACTGCATCCGCGTGGCCTTATGACCTCCTTGCCCACTCACAGAGGCTGGAGGCAGCGACACTGGAACGGAGAAGAGAGATCTGCATGAGGGTGAGAACAC

ACACCTACTCCCACCCAAGGACTCAGAACAACATGGCTTTTTGATCGGTACCAACCGACCTACATCAATTAGTTATTGGACTTCACAAAGATTTGCCGCT

GTGGATCAAACAGGACCACCTCCCTCTGCGTCAGCCATTTAAAATTGGGGGAGGGAAGAGATCCAGTGCAAGTGTGGGAAGAAACTGGAATGACGATTTT

GATTAGGCCACGTAGGGTGAAAACCGC
Translation
 - UNI6970 - - UNI30999 -  - UNI30999 - MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQP

VHILR - UNI30999 - - UNI33313 - RRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKH - UNI2746 - - U

NI33313 - DVKVFSEDGTSKVVEILTDMTARDLCQLLVYKSHCVDDNSWTLVEHHPQLGLE - UNI10095 - ERCLEDHEIVVQVESTMPSESKF

LFRKNYAKYEFFKNPV - UNI29422 - NFFPDQMVNWCQQSNGGQAQLLQ NFLNTSSCPEIQGFLQVKEVGRKSWKKLYVCLRRSGLYYSTKGTSK

 EPRHLQLLADLEESSIFYLIAGKKQYNAPNEHGMCIK - UNI29790 - PNKAKTEMKELRLLCAEDEQIRTCWMTAFRLLK - UNI29790 - Y

GMLLYQNYRIPQRKGLPPPFNAPM - UNI29790 - RSVSENSLVAMDFSGQIGRVIDNPAEAQSAALEEGHAWR KRSTRMNILSSQSPLHPSTLNA

V - UNI29283 - VIHRTQHWFHGRISREESHRIIKQQGLVDG GLFLLRDSQSNPKAFVLTLCHHQKIKNFQILP CEDDGQTFFTLDDGNTKFSDL

IQLVDFYQLNKGVLPCKLKHHCIRVAL
Transcript ENSMUST00000079913
Sequence
GGGAGGCGGCAGGAAGGGAAGGGCGCTGCGACCAGTGGCGGGCGGGATTCGCGTTCCGAGACCCACGGGAGCACGAAGTTTCCGCGCACCGTCTCACGCA

CGGCGACTGGGACCGTCCAGTGTCCGGCTTTGCCTTCGGTTTTTCTCCGTTGTGACTCGTGCAACGTGTGGCCAGCGGCCACGCGGAGGCGACGAGGAGC

TGCACGTCAG - UNI6970 - - UNI30999 - GACAAAGTGGGGCAGTCAACGTCCAAACCCGAAAACCTAGCTAAGTCTGGGTTTTCGCCACAAC

AAAGAAGCCAACCAG - UNI30999 - AGCATGGTCTTGGGCTTCAAGTACTAATGAACAACGATATTAACTCGTCCGTGGAAAGCCTTAACTCAGCT

TGCAACATGCAGTCTGATACTGATACTGCACCACTTCTTGAGGATGGCCAGCATGCCAGCAACCAGGGAGCAGCATCTAGCTCCCGGGGACAGCCACAGG

CGTCCCCGAGGCAGAAAATGCAACGCTCGCAGCCTGTGCACATTCTCAG - UNI30999 - - UNI33313 - GCGCCTTCAGGAGGAAGACCAGCA

GTTAAGAACTGCATCTCTTCCGGCCATCCCCAACCCATTTCCGGAGCTCACTGGTGCGGCCCCTGGGAGCCCTCCTTCGGTTGCTCCTAGCTCCTTACCT

CCTCCTCCGAGCCAGCCACCTGCCAAGCAT - UNI2746 - - UNI33313 - TTCCCTCCAGGCTTTCAGCTGTCGAAACTCACCCGTCCAGGTCT

GTGGACAAAGACCACTGCGAGATTTTCAAAGAAACAACCTAAGAACCAGTGTCCAACCGACACTGTGAATCCAGTGGCACGGATGCCCACTTCACAGATG

GAGAAGCTGAGGCTCAGAAAG GATGTCAAAGTCTTTAGTGAAGATGGGACCAGCAAAGTGGTGGAGATTCTAACCGACATGACAGCCAGGGACCTGTGC

CAGCTGCTGGTTTACAAAAGTCACTGTGTGGATGACAACAGCTGGACTCTGGTGGAACACCACCCACAACTGGGATTAG - UNI10095 - AGAGGTG

CCTGGAGGACCATGAGATCGTGGTCCAAGTGGAGAGTACCATGCCAAGTGAGAGCAAATTCTTATTCAGAAAGAATTATGCGAAGTACGAGTTCTTTAAG

AATCCAGTG - UNI29422 - AACTTCTTCCCGGATCAGATGGTCAATTGGTGCCAGCAGTCCAACGGTGGCCAGGCGCAGCTTCTGCAG GAACCCA

GACACCTGCAGCTGCTGGCTGACCTGGAAGAAAGCAGCATCTTCTACCTGATTGCTGGAAAGAAGCAGTACAACGCGCCGAATGAACATGGGATGTGCAT

CAAG - UNI29790 - CCAAACAAAGCGAAGACCGAGATGAAGGAGCTTCGTCTGCTCTGTGCCGAAGATGAGCAGATCCGTACTTGCTGGATGACTG

CCTTCAGACTGCTCAAG - UNI29790 - TACGGAATGCTCCTGTACCAAAACTATCGCATCCCACAGAGGAAGGGTCTGCCCCCTCCTTTCAACGCA

CCTATG - UNI29790 - CGCAGTGTTTCTGAGAATTCTCTTGTGGCCATGGATTTTTCTGGACAAATCGGAAGAGTGATCGATAACCCGGCTGAAGC

CCAGAGTGCTGCCCTGGAAGAGGGCCATGCCTGGCGT AAGCGGAGCACACGGATGAATATCCTAAGCAGCCAAAGCCCACTGCATCCTTCTACCCTGAA

TGCAG - UNI29283 - TGATTCACAGGACTCAGCATTGGTTCCATGGACGTATCTCCCGCGAGGAGTCTCACAGGATCATCAAGCAACAAGGTCTCG

TGGACGG GCTGTTCCTCCTTCGTGACAGCCAGAGTAATCCAAAGGCGTTCGTACTGACACTGTGCCATCACCAGAAGATTAAAAACTTCCAGATCTTAC

CT TGCGAGGATGATGGGCAGACCTTCTTCACTCTGGATGATGGGAACACCAAGTTCTCCGATCTGATCCAGCTGGTCGACTTCTACCAGCTCAACAAAG

GTGTTCTGCCCTGCAAGCTGAAACACCACTGCATCCGCGTGGCCTTATGACCTCCTTGCCCACTCACAGAGGCTGGAGGCAGCGACACTGGAACGGAGAA

GAGAGATCTGCATGAGGGTGAGAACACACACCTACTCCCACCCAAGGACTCAGAACAACATGGCTTTTTGATCGGTACCAACCGACCTACATCAATTAGT

TATTGGACTTCACAAAGATTTGCCGCTGTGGATCAAACAGGACCACCTCCCTCTGCGTCAGCCATTTAAAATTGGGGGAGGGAAGAGATCCAGTGCAAGT

GTGGGAAGAAACTGGAATGACGATTTTGATTAGGCCACGTAGGGTGAAAACCGC
Translation
 - UNI6970 - - UNI30999 -  - UNI30999 - MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQP

VHILR - UNI30999 - - UNI33313 - RRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKH - UNI2746 - - U

NI33313 - FPPGFQLSKLTRPGLWTKTTARFSKKQPKNQCPTDTVNPVARMPTSQMEKLRLRK DVKVFSEDGTSKVVEILTDMTARDLCQLLVYKSH

CVDDNSWTLVEHHPQLGLE - UNI10095 - ERCLEDHEIVVQVESTMPSESKFLFRKNYAKYEFFKNPV - UNI29422 - NFFPDQMVNWCQQS

NGGQAQLLQ EPRHLQLLADLEESSIFYLIAGKKQYNAPNEHGMCIK - UNI29790 - PNKAKTEMKELRLLCAEDEQIRTCWMTAFRLLK - UNI

29790 - YGMLLYQNYRIPQRKGLPPPFNAPM - UNI29790 - RSVSENSLVAMDFSGQIGRVIDNPAEAQSAALEEGHAWR KRSTRMNILSSQS

PLHPSTLNAV - UNI29283 - VIHRTQHWFHGRISREESHRIIKQQGLVDG GLFLLRDSQSNPKAFVLTLCHHQKIKNFQILP CEDDGQTFFTLD

DGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Transcript ENSMUST00000093321
Sequence
GGGAGGCGGCAGGAAGGGAAGGGCGCTGCGACCAGTGGCGGGCGGGATTCGCGTTCCGAGACCCACGGGAGCACGAAGTTTCCGCGCACCGTCTCACGCA

CGGCGACTGGGACCGTCCAGTGTCCGGCTTTGCCTTCGGTTTTTCTCCGTTGTGACTCGTGCAACGTGTGGCCAGCGGCCACGCGGAGGCGACGAGGAGC

TGCACGTCAG - UNI6970 - - UNI30999 - GACAAAGTGGGGCAGTCAACGTCCAAACCCGAAAACCTAGCTAAGTCTGGGTTTTCGCCACAAC

AAAGAAGCCAACCAG - UNI30999 - AGCATGGTCTTGGGCTTCAAGTACTAATGAACAACGATATTAACTCGTCCGTGGAAAGCCTTAACTCAGCT

TGCAACATGCAGTCTGATACTGATACTGCACCACTTCTTGAGGATGGCCAGCATGCCAGCAACCAGGGAGCAGCATCTAGCTCCCGGGGACAGCCACAGG

CGTCCCCGAGGCAGAAAATGCAACGCTCGCAGCCTGTGCACATTCTCAG - UNI30999 - - UNI33313 - GCGCCTTCAGGAGGAAGACCAGCA

GTTAAGAACTGCATCTCTTCCGGCCATCCCCAACCCATTTCCGGAGCTCACTGGTGCGGCCCCTGGGAGCCCTCCTTCGGTTGCTCCTAGCTCCTTACCT

CCTCCTCCGAGCCAGCCACCTGCCAAGCAT - UNI2746 - - UNI33313 - TTCCCTCCAGGCTTTCAGCTGTCGAAACTCACCCGTCCAGGTCT

GTGGACAAAGACCACTGCGAGATTTTCAAAGAAACAACCTAAGAACCAGTGTCCAACCGACACTGTGAATCCAGTGGCACGGATGCCCACTTCACAGATG

GAGAAGCTGAGGCTCAGAAAG GATGTCAAAGTCTTTAGTGAAGATGGGACCAGCAAAGTGGTGGAGATTCTAACCGACATGACAGCCAGGGACCTGTGC

CAGCTGCTGGTTTACAAAAGTCACTGTGTGGATGACAACAGCTGGACTCTGGTGGAACACCACCCACAACTGGGATTAG - UNI10095 - AGAGGTG

CCTGGAGGACCATGAGATCGTGGTCCAAGTGGAGAGTACCATGCCAAGTGAGAGCAAATTCTTATTCAGAAAGAATTATGCGAAGTACGAGTTCTTTAAG

AATCCAGTG - UNI29422 - AACTTCTTCCCGGATCAGATGGTCAATTGGTGCCAGCAGTCCAACGGTGGCCAGGCGCAGCTTCTGCAG AATTTTC

TGAACACCAGCAGCTGCCCTGAGATCCAGGGGTTCTTGCAGGTGAAAGAGGTAGGACGCAAGTCTTGGAAGAAGCTGTATGTGTGCCTGCGCAGATCTGG

CCTCTATTACTCCACCAAGGGGACTTCAAAA GAACCCAGACACCTGCAGCTGCTGGCTGACCTGGAAGAAAGCAGCATCTTCTACCTGATTGCTGGAAA

GAAGCAGTACAACGCGCCGAATGAACATGGGATGTGCATCAAG - UNI29790 - CCAAACAAAGCGAAGACCGAGATGAAGGAGCTTCGTCTGCTCT

GTGCCGAAGATGAGCAGATCCGTACTTGCTGGATGACTGCCTTCAGACTGCTCAAG - UNI29790 - TACGGAATGCTCCTGTACCAAAACTATCGC

ATCCCACAGAGGAAGGGTCTGCCCCCTCCTTTCAACGCACCTATG - UNI29790 - CGCAGTGTTTCTGAGAATTCTCTTGTGGCCATGGATTTTTC

TGGACAAATCGGAAGAGTGATCGATAACCCGGCTGAAGCCCAGAGTGCTGCCCTGGAAGAGGGCCATGCCTGGCGT AAGCGGAGCACACGGATGAATAT

CCTAAGCAGCCAAAGCCCACTGCATCCTTCTACCCTGAATGCAG - UNI29283 - TGATTCACAGGACTCAGCATTGGTTCCATGGACGTATCTCCC

GCGAGGAGTCTCACAGGATCATCAAGCAACAAGGTCTCGTGGACGG GCTGTTCCTCCTTCGTGACAGCCAGAGTAATCCAAAGGCGTTCGTACTGACAC

TGTGCCATCACCAGAAGATTAAAAACTTCCAGATCTTACCT TGCGAGGATGATGGGCAGACCTTCTTCACTCTGGATGATGGGAACACCAAGTTCTCCG

ATCTGATCCAGCTGGTCGACTTCTACCAGCTCAACAAAGGTGTTCTGCCCTGCAAGCTGAAACACCACTGCATCCGCGTGGCCTTATGACCTCCTTGCCC

ACTCACAGAGGCTGGAGGCAGCGACACTGGAACGGAGAAGAGAGATCTGCATGAGGGTGAGAACACACACCTACTCCCACCCAAGGACTCAGAACAACAT

GGCTTTTTGATCGGTACCAACCGACCTACATCAATTAGTTATTGGACTTCACAAAGATTTGCCGCTGTGGATCAAACAGGACCACCTCCCTCTGCGTCAG

CCATTTAAAATTGGGGGAGGGAAGAGATCCAGTGCAAGTGTGGGAAGAAACTGGAATGACGATTTTGATTAGGCCACGTAGGGTGAAAACCGC
Translation
 - UNI6970 - - UNI30999 -  - UNI30999 - MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQP

VHILR - UNI30999 - - UNI33313 - RRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKH - UNI2746 - - U

NI33313 - FPPGFQLSKLTRPGLWTKTTARFSKKQPKNQCPTDTVNPVARMPTSQMEKLRLRK DVKVFSEDGTSKVVEILTDMTARDLCQLLVYKSH

CVDDNSWTLVEHHPQLGLE - UNI10095 - ERCLEDHEIVVQVESTMPSESKFLFRKNYAKYEFFKNPV - UNI29422 - NFFPDQMVNWCQQS

NGGQAQLLQ NFLNTSSCPEIQGFLQVKEVGRKSWKKLYVCLRRSGLYYSTKGTSK EPRHLQLLADLEESSIFYLIAGKKQYNAPNEHGMCIK - UNI

29790 - PNKAKTEMKELRLLCAEDEQIRTCWMTAFRLLK - UNI29790 - YGMLLYQNYRIPQRKGLPPPFNAPM - UNI29790 - RSVSEN

SLVAMDFSGQIGRVIDNPAEAQSAALEEGHAWR KRSTRMNILSSQSPLHPSTLNAV - UNI29283 - VIHRTQHWFHGRISREESHRIIKQQGLVD

G GLFLLRDSQSNPKAFVLTLCHHQKIKNFQILP CEDDGQTFFTLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Transcript ENSMUST00000078449
Sequence
GGGAGGCGGCAGGAAGGGAAGGGCGCTGCGACCAGTGGCGGGCGGGATTCGCGTTCCGAGACCCACGGGAGCACGAAGTTTCCGCGCACCGTCTCACGCA

CGGCGACTGGGACCGTCCAGTGTCCGGCTTTGCCTTCGGTTTTTCTCCGTTGTGACTCGTGCAACGTGTGGCCAGCGGCCACGCGGAGGCGACGAGGAGC

TGCACGTCAG - UNI6970 - - UNI30999 - GACAAAGTGGGGCAGTCAACGTCCAAACCCGAAAACCTAGCTAAGTCTGGGTTTTCGCCACAAC

AAAGAAGCCAACCAG - UNI30999 - AGCATGGTCTTGGGCTTCAAGTACTAATGAACAACGATATTAACTCGTCCGTGGAAAGCCTTAACTCAGCT

TGCAACATGCAGTCTGATACTGATACTGCACCACTTCTTGAGGATGGCCAGCATGCCAGCAACCAGGGAGCAGCATCTAGCTCCCGGGGACAGCCACAGG

CGTCCCCGAGGCAGAAAATGCAACGCTCGCAGCCTGTGCACATTCTCAG - UNI30999 - - UNI33313 - GCGCCTTCAGGAGGAAGACCAGCA

GTTAAGAACTGCATCTCTTCCGGCCATCCCCAACCCATTTCCGGAGCTCACTGGTGCGGCCCCTGGGAGCCCTCCTTCGGTTGCTCCTAGCTCCTTACCT

CCTCCTCCGAGCCAGCCACCTGCCAAGCAT - UNI33313 - TGTGGCAGATGTGAGAAGTGGATACCAGGGGAAAATACCCGGGGAAATGGGAAACG

GAAGATCTGGAGATGGCAG - UNI2746 - - UNI33313 - TTCCCTCCAGGCTTTCAGCTGTCGAAACTCACCCGTCCAGGTCTGTGGACAAAGA

CCACTGCGAGATTTTCAAAGAAACAACCTAAGAACCAGTGTCCAACCGACACTGTGAATCCAGTGGCACGGATGCCCACTTCACAGATGGAGAAGCTGAG

GCTCAGAAAG GATGTCAAAGTCTTTAGTGAAGATGGGACCAGCAAAGTGGTGGAGATTCTAACCGACATGACAGCCAGGGACCTGTGCCAGCTGCTGGT

TTACAAAAGTCACTGTGTGGATGACAACAGCTGGACTCTGGTGGAACACCACCCACAACTGGGATTAG - UNI10095 - AGAGGTGCCTGGAGGACC

ATGAGATCGTGGTCCAAGTGGAGAGTACCATGCCAAGTGAGAGCAAATTCTTATTCAGAAAGAATTATGCGAAGTACGAGTTCTTTAAGAATCCAGTG -

 UNI29422 - AACTTCTTCCCGGATCAGATGGTCAATTGGTGCCAGCAGTCCAACGGTGGCCAGGCGCAGCTTCTGCAG AATTTTCTGAACACCAGC

AGCTGCCCTGAGATCCAGGGGTTCTTGCAGGTGAAAGAGGTAGGACGCAAGTCTTGGAAGAAGCTGTATGTGTGCCTGCGCAGATCTGGCCTCTATTACT

CCACCAAGGGGACTTCAAAA GAACCCAGACACCTGCAGCTGCTGGCTGACCTGGAAGAAAGCAGCATCTTCTACCTGATTGCTGGAAAGAAGCAGTACA

ACGCGCCGAATGAACATGGGATGTGCATCAAG - UNI29790 - CCAAACAAAGCGAAGACCGAGATGAAGGAGCTTCGTCTGCTCTGTGCCGAAGAT

GAGCAGATCCGTACTTGCTGGATGACTGCCTTCAGACTGCTCAAG - UNI29790 - TACGGAATGCTCCTGTACCAAAACTATCGCATCCCACAGAG

GAAGGGTCTGCCCCCTCCTTTCAACGCACCTATG - UNI29790 - CGCAGTGTTTCTGAGAATTCTCTTGTGGCCATGGATTTTTCTGGACAAATCG

GAAGAGTGATCGATAACCCGGCTGAAGCCCAGAGTGCTGCCCTGGAAGAGGGCCATGCCTGGCGT AAGCGGAGCACACGGATGAATATCCTAAGCAGCC

AAAGCCCACTGCATCCTTCTACCCTGAATGCAG - UNI29283 - TGATTCACAGGACTCAGCATTGGTTCCATGGACGTATCTCCCGCGAGGAGTCT

CACAGGATCATCAAGCAACAAGGTCTCGTGGACGG GCTGTTCCTCCTTCGTGACAGCCAGAGTAATCCAAAGGCGTTCGTACTGACACTGTGCCATCAC

CAGAAGATTAAAAACTTCCAGATCTTACCT TGCGAGGATGATGGGCAGACCTTCTTCACTCTGGATGATGGGAACACCAAGTTCTCCGATCTGATCCAG

CTGGTCGACTTCTACCAGCTCAACAAAGGTGTTCTGCCCTGCAAGCTGAAACACCACTGCATCCGCGTGGCCTTATGACCTCCTTGCCCACTCACAGAGG

CTGGAGGCAGCGACACTGGAACGGAGAAGAGAGATCTGCATGAGGGTGAGAACACACACCTACTCCCACCCAAGGACTCAGAACAACATGGCTTTTTGAT

CGGTACCAACCGACCTACATCAATTAGTTATTGGACTTCACAAAGATTTGCCGCTGTGGATCAAACAGGACCACCTCCCTCTGCGTCAGCCATTTAAAAT

TGGGGGAGGGAAGAGATCCAGTGCAAGTGTGGGAAGAAACTGGAATGACGATTTTGATTAGGCCACGTAGGGTGAAAACCGC
Translation
 - UNI6970 - - UNI30999 -  - UNI30999 - MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQP

VHILR - UNI30999 - - UNI33313 - RRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKH - UNI33313 - CG

RCEKWIPGENTRGNGKRKIWRWQ - UNI2746 - - UNI33313 - FPPGFQLSKLTRPGLWTKTTARFSKKQPKNQCPTDTVNPVARMPTSQMEKL

RLRK DVKVFSEDGTSKVVEILTDMTARDLCQLLVYKSHCVDDNSWTLVEHHPQLGLE - UNI10095 - ERCLEDHEIVVQVESTMPSESKFLFRKN

YAKYEFFKNPV - UNI29422 - NFFPDQMVNWCQQSNGGQAQLLQ NFLNTSSCPEIQGFLQVKEVGRKSWKKLYVCLRRSGLYYSTKGTSK EPRH

LQLLADLEESSIFYLIAGKKQYNAPNEHGMCIK - UNI29790 - PNKAKTEMKELRLLCAEDEQIRTCWMTAFRLLK - UNI29790 - YGMLLY

QNYRIPQRKGLPPPFNAPM - UNI29790 - RSVSENSLVAMDFSGQIGRVIDNPAEAQSAALEEGHAWR KRSTRMNILSSQSPLHPSTLNAV - U

NI29283 - VIHRTQHWFHGRISREESHRIIKQQGLVDG GLFLLRDSQSNPKAFVLTLCHHQKIKNFQILP CEDDGQTFFTLDDGNTKFSDLIQLVD

FYQLNKGVLPCKLKHHCIRVAL

For any suggestions or comments, please send an email to unitrap@crg.es