Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020182 (Ddc)
Chromosomal location
Chr 11: 11714104 - 11798047 (-)
Description
dopa decarboxylase Gene [Source:MGI (curated);Acc:Ddc-001]
RefSeq_dna
NM_016672 
RefSeq_peptide
NP_057881.1 
UniGene
Mm.12906 
MGI
MGI:94876 
Uniprot/SWISSPROT
O88533 
Uniprot/SPTREMBL
Q3TUH2 O35958 Q5SUV8 Q5SUV9 
Human Ortholog
ENSG00000132437 (DDC)
Omim 608643 - AROMATIC L-AMINO ACID DECARBOXYLASE DEFICIENCY  
UniTrap UNI31265
Vector Insertion
Chr 11: 11790340 - 11798048
Public Clones IST11712F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17654
Vector Insertion
Chr 11: 11780654 - 11790340
Public Clones CMHD-GT_476H10-3 (cmhd) IST10263E12HMF1 (tigm) IST10335C12 (tigm) IST12890G11 (tigm)
IST12316C3 (tigm) IST10491A1 (tigm) IST14832B9 (tigm) IST11040D4 (tigm)
Private Clones OST438849 (lexicon) OST416164 (lexicon) OST377270 (lexicon) OST372443 (lexicon)
OST68931 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26234
Vector Insertion
Chr 11: 11776362 - 11780444
Public Clones IST10237E2 (tigm) IST12656E12 (tigm) IST10196G5 (tigm) IST12479H10 (tigm)
IST11566G7 (tigm) IST12077F11 (tigm) IST12988G7 (tigm)
Private Clones OST129277 (lexicon) OST43571 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14679
Vector Insertion
Chr 11: 11764896 - 11773257
Public Clones FHCRC-GT-S1-9B1 (fhcrc) IST13405B2 (tigm) IST14885C10 (tigm) IST11099G11 (tigm)
IST13075A8 (tigm) IST10258A2 (tigm) IST10230F3 (tigm) IST10762G3 (tigm)
IST12234C2 (tigm) IST13065H8 (tigm) IST12486F10 (tigm)
Private Clones OST181948 (lexicon) OST60104 (lexicon) OST34352 (lexicon) OST8556 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36317
Vector Insertion
Chr 11: 11763653 - 11765032
Public Clones IST11466A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27039
Vector Insertion
Chr 11: 11746706 - 11763653
Public Clones CMHD-GT_534E10-5S (cmhd) IST11191H6 (tigm) IST14711A10 (tigm) IST10362G8 (tigm)
IST12149G11 (tigm)
Private Clones OST77155 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33258
Vector Insertion
Chr 11: 11735744 - 11739496
Public Clones IST14907F1 (tigm) IST11742F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21463
Vector Insertion
Chr 11: 11729182 - 11735744
Public Clones (sanger) IST14937C7 (tigm) IST10325B1 (tigm) IST11322F6 (tigm) IST10755E3 (tigm)
IST10063D7 (tigm) IST10385H10 (tigm) IST12488G11 (tigm) IST12717B12 (tigm)
IST11490F4 (tigm) IST11804D6 (tigm)
Private Clones OST329553 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30688
Vector Insertion
Chr 11: 11724851 - 11729182
Public Clones (sanger) 3SE224G09 (ggtc) 5SE224G09 (ggtc) IST11723E8HMF1 (tigm) IST10800C7 (tigm)
IST11677C9 (tigm) IST14832A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30904
Vector Insertion
Chr 11: 11722197 - 11724872
Public Clones IST11368B8 (tigm) IST11118B5 (tigm) IST14703D9 (tigm) IST11920E6 (tigm)
IST11118G4 (tigm) IST10609H3 (tigm) IST10702B11 (tigm) IST11140G5 (tigm)
IST10594G9 (tigm) IST10373H1 (tigm) IST12467F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28970
Vector Insertion
Chr 11: 11719396 - 11722197
Public Clones IST10063C1 (tigm) IST12057C7 (tigm) IST11189B1 (tigm) IST13068C2 (tigm)
IST11753C5 (tigm) IST13036C5 (tigm)
Private Clones OST14583 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20970
Vector Insertion
Chr 11: 11714105 - 11714521
Public Clones not available
Private Clones OST347080 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101512
Sequence
AACTGTCACCAAGGAGAGAGAGAGAGCAAGAGAGCGAATAGAGAGGAGGCGACTCCAGCTGCCT - UNI17654 - - UNI31265 - TTTTCAACA

TGGATTCCCGTGAATTCCGGAGGAGAGGCAAGGAGATGGTGGATTATATAGCTGACTATCTGGATGGCATTGAGGGTCGTCCAGTGTACCCTGATGTGGA

GCCTGGCTATCTTCGGCCCCTGATCCCTGCCACTGCCCCCCAGGAGCCAGAAACATACGAGGACATAATCAAAGACATCGAGAAGATAATCATGCCAGGG

 - UNI26234 - GTGACACACTGGCACAGTCCCTATTTCTTCGCTTACTTCCCCACGGCTAGCTCATACCCAGCTATGCTTGCAGACATGCTGTGTGG

TGCTATTGGCTGCATTGGTTTCTCCTGG TTCAAGGTTGTGAAGCTTCCATTCCCCCAAGACCAGAAGATTGCTATGCACTCTGACTTTGGAGACGGTTC

CTACCCTTGA
Translation
 - UNI17654 - - UNI31265 - MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPG - UNI

26234 - VTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSW FKVVKLPFPQDQKIAMHSDFGDGSYP
Transcript ENSMUST00000066237
Sequence
AGTGGACCTGTGAAGAATCCAAATTCCAAGCAAGTAA - UNI17654 - - UNI31265 - TTTTCAACATGGATTCCCGTGAATTCCGGAGGAGAG

GCAAGGAGATGGTGGATTATATAGCTGACTATCTGGATGGCATTGAGGGTCGTCCAGTGTACCCTGATGTGGAGCCTGGCTATCTTCGGCCCCTGATCCC

TGCCACTGCCCCCCAGGAGCCAGAAACATACGAGGACATAATCAAAGACATCGAGAAGATAATCATGCCAGGG - UNI26234 - GTGACACACTGGC

ACAGTCCCTATTTCTTCGCTTACTTCCCCACGGCTAGCTCATACCCAGCTATGCTTGCAGACATGCTGTGTGGTGCTATTGGCTGCATTGGTTTCTCCTG

G - UNI14679 - GCTGCAAGCCCAGCGTGCACAGAGCTGGAGACCGTGATGATGGACTGGCTGGGGAAGATGCTGGAGCTGCCAGAGGCCTTTTTGG

CTGGAAGAGCTGGGGAAGGGGGAGGAGTGATCCAG - UNI14679 - GGAAGTGCCAGTGAAGCCACCTTGGTGGCCCTACTGGCTGCTCGGACTAAA

GTTATCCGCCAGCTGCAGGCAGCCTCCCCAGAGTTCACACAAGCTGCTATCATGGAAAAGCTGGTTGCTTACACATCTGATCAG - UNI14679 - GC

GCATTCCTCTGTAGAAAGAGCTGGGTTAATTGGTGGAATAAAGCTAAAAGCAGTCCCTTCGGATGGCAACTTTTCCATGAGAGCTTCTGCCCTTCGGGAA

GCCCTGGAGCGGGACAAGGCAGCTGGCCTGATTCCATTCTTT - UNI27039 - GTGGTCGCTACACTGGGGACCACATCCTGCTGTTCTTTTGACAA

TCTCCTGGAAGTGGGTCCCATCT - UNI33258 - GCAACCAGGAGGGTGTGTGGCTGCACATTGACGCTGCTTACGCGGGCAGTGCCTTTATCTGTC

CTGAATTCCGGTATCTTCTGAATGGTGTGGAG - UNI33258 - TTTGCAGATTCCTTTAACTTTAATCCCCACAAGTGGCTTTTGGTGAACTTTGAC

TGCTCTGCCATGTG - UNI21463 - - UNI30688 - - UNI33258 - GGTGAAGAGGAGGACTGACTTAACCGGAGCCTTTAATATGGACCCT

GTTTATCTAAAGCACAGTCACCAGGACTCAG - UNI30688 - - UNI30904 - GATTCATCACTGACTACAGG - UNI30688 - - UNI309

04 - CACTGGCAGATCCCACTGGGGCGACGATTTCGCTCTTTGAAAATGTGGTTTGTTTTTAGAATGTACGGAGTCAAGGGGCTGCAGGCTTACATCCG

AAAG - UNI28970 - - UNI30904 - CACGTGGAGCTGTCTCATGAGTTTGAGTCACTGGTACGCCAGGACCCTCGCTTTGAAATTTGCACAGAA

GTCATTCTTGGGTTGGTCTGCTTCCGGCTAAAG GGCTCCAATGAGTTGAACGAAACTCTCTTACAAAGAATAAACAGCGCCAAAAAAATCCACTTGGTT

CCATGTCGTCTCCGAGACAAGTTTGTGCTACGCTTTGCTGTGTGCGCTCGCACTGTGGAGTCTGCCCACGTGCAGCTGGCCTGGGAACACATCAGTGATC

TAGCAAGCAGTGTGCTGAGGGCAGAGAAAGAATGAAAGCAGAGCTGCTTCAG - UNI20970 - AGATCAAAAGTTGAAAAGAAGTTTATCTGAAAAC

TGGAAAGAGAAAAATAACTACCACTCCGTCTTCGTGAAATCATGATTACATGTGGCGTCATGTGTGTCTCCAACATTAACCAGAAACCTCTGACTGACTT

TTTGGTGACTTATCAATGAAGAAATATTTTCTGTATTGTCCAGGGAAAAGTATTTTCTGTGTGGAAAGCTATTGTCAGTGGCTCTAGCTTCTGTTCTTTG

TGTGGCCGTGACTTCTGTTGATAATAAGATGTCTTTGTGCTCATAAGGTCATTGGTGGCAGGATAGGCTTATAGAAATAGTTTCCAGGGCAGTCTTTGGT

CTTACCTTCAGAGTATATCTATGGCTGTTAACTTATCCTCTGTGTGGCTAAATACTAAATAAACAACCTATGTGCAATACTAA
Translation
 - UNI17654 - - UNI31265 - MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPG - UNI

26234 - VTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSW - UNI14679 - AASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQ

 - UNI14679 - GSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQ - UNI14679 - AHSSVERAGLIGGIKLKAVPSDGNFSM

RASALREALERDKAAGLIPFF - UNI27039 - VVATLGTTSCCSFDNLLEVGPIC - UNI33258 - CNQEGVWLHIDAAYAGSAFICPEFRYLL

NGVE - UNI33258 - FADSFNFNPHKWLLVNFDCSAMW - UNI21463 - - UNI30688 - - UNI33258 - WVKRRTDLTGAFNMDPVYL

KHSHQDSG - UNI30688 - - UNI30904 - GFITDYR - UNI30688 - - UNI30904 - HWQIPLGRRFRSLKMWFVFRMYGVKGLQAYI

RK - UNI28970 - - UNI30904 - HVELSHEFESLVRQDPRFEICTEVILGLVCFRLK GSNELNETLLQRINSAKKIHLVPCRLRDKFVLRFAV

CARTVESAHVQLAWEHISDLASSVLRAEKE - UNI20970 - 
Transcript ENSMUST00000109659
Sequence
AACTGTCACCAAGGAGAGAGAGAGAGCAAGAGAGCGAATAGAGAGGAGGCGACTCCAGCTGCCT - UNI17654 - - UNI31265 - TTTTCAACA

TGGATTCCCGTGAATTCCGGAGGAGAGGCAAGGAGATGGTGGATTATATAGCTGACTATCTGGATGGCATTGAGGGTCGTCCAGTGTACCCTGATGTGGA

GCCTGGCTATCTTCGGCCCCTGATCCCTGCCACTGCCCCCCAGGAGCCAGAAACATACGAGGACATAATCAAAGACATCGAGAAGATAATCATGCCAGGG

 - UNI26234 - GTGACACACTGGCACAGTCCCTATTTCTTCGCTTACTTCCCCACGGCTAGCTCATACCCAGCTATGCTTGCAGACATGCTGTGTGG

TGCTATTGGCTGCATTGGTTTCTCCTGG - UNI14679 - GCTGCAAGCCCAGCGTGCACAGAGCTGGAGACCGTGATGATGGACTGGCTGGGGAAGA

TGCTGGAGCTGCCAGAGGCCTTTTTGGCTGGAAGAGCTGGGGAAGGGGGAGGAGTGATCCAG - UNI14679 - GGAAGTGCCAGTGAAGCCACCTTG

GTGGCCCTACTGGCTGCTCGGACTAAAGTTATCCGCCAGCTGCAGGCAGCCTCCCCAGAGTTCACACAAGCTGCTATCATGGAAAAGCTGGTTGCTTACA

CATCTGATCAG - UNI14679 - GCGCATTCCTCTGTAGAAAGAGCTGGGTTAATTGGTGGAATAAAGCTAAAAGCAGTCCCTTCGGATGGCAACTTT

TCCATGAGAGCTTCTGCCCTTCGGGAAGCCCTGGAGCGGGACAAGGCAGCTGGCCTGATTCCATTCTTT - UNI27039 - GTGGTCGCTACACTGGG

GACCACATCCTGCTGTTCTTTTGACAATCTCCTGGAAGTGGGTCCCATCT - UNI33258 - GCAACCAGGAGGGTGTGTGGCTGCACATTGACGCTG

CTTACGCGGGCAGTGCCTTTATCTGTCCTGAATTCCGGTATCTTCTGAATGGTGTGGAG - UNI33258 - TTTGCAGATTCCTTTAACTTTAATCCC

CACAAGTGGCTTTTGGTGAACTTTGACTGCTCTGCCATGTG - UNI21463 - - UNI30688 - - UNI33258 - GGTGAAGAGGAGGACTGAC

TTAACCGGAGCCTTTAATATGGACCCTGTTTATCTAAAGCACAGTCACCAGGACTCAG - UNI30688 - - UNI30904 - GATTCATCACTGACT

ACAGG - UNI30688 - - UNI30904 - CACTGGCAGATCCCACTGGGGCGACGATTTCGCTCTTTGAAAATGTGGTTTGTTTTTAGAATGTACGG

AGTCAAGGGGCTGCAGGCTTACATCCGAAAG - UNI28970 - - UNI30904 - CACGTGGAGCTGTCTCATGAGTTTGAGTCACTGGTACGCCAG

GACCCTCGCTTTGAAATTTGCACAGAAGTCATTCTTGGGTTGGTCTGCTTCCGGCTAAAG GGCTCCAATGAGTTGAACGAAACTCTCTTACAAAGAATA

AACAGCGCCAAAAAAATCCACTTGGTTCCATGTCGTCTCCGAGACAAGTTTGTGCTACGCTTTGCTGTGTGCGCTCGCACTGTGGAGTCTGCCCACGTGC

AGCTGGCCTGGGAACACATCAGTGATCTAGCAAGCAGTGTGCTGAGGGCAGAGAAAGAATGAAAGCAGAGCTGCTTCAG - UNI20970 - AGATCAA

AAGTTGAAAAGAAGTTTATCTGAAAACTGGAAAGAGAAAAATAACTACCACTCCGTCTTCGTGAAATCATGATTACATGTGGCGTCATGTGTGTCTCCAA

CATTAACCAGAAACCTCTGACTGACTTTTTGGTGACTTATCAATGAAGAAATATTTTCTGTATTGTCCAGGGAAAAGTATTTTCTGTGTGGAAAGCTATT

GTCAGTGGCTCTAGCTTCTGTTCTTTGTGTGGCCGTGACTTCTGTTGATAATAAGATGTCTTTGTGCTCATAAGGTCATTGGTGGCAGGATAGGCTTATA

GAAATAGTTTCCAGGGCAGTCTTTGGTCTTACCTTCAGAGTATATCTATGGCTGTTAACTTATCCTCTGTGTGGCTAAATACTAAATAAACAACCTATGT

GCAATACT
Translation
 - UNI17654 - - UNI31265 - MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPG - UNI

26234 - VTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSW - UNI14679 - AASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQ

 - UNI14679 - GSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQ - UNI14679 - AHSSVERAGLIGGIKLKAVPSDGNFSM

RASALREALERDKAAGLIPFF - UNI27039 - VVATLGTTSCCSFDNLLEVGPIC - UNI33258 - CNQEGVWLHIDAAYAGSAFICPEFRYLL

NGVE - UNI33258 - FADSFNFNPHKWLLVNFDCSAMW - UNI21463 - - UNI30688 - - UNI33258 - WVKRRTDLTGAFNMDPVYL

KHSHQDSG - UNI30688 - - UNI30904 - GFITDYR - UNI30688 - - UNI30904 - HWQIPLGRRFRSLKMWFVFRMYGVKGLQAYI

RK - UNI28970 - - UNI30904 - HVELSHEFESLVRQDPRFEICTEVILGLVCFRLK GSNELNETLLQRINSAKKIHLVPCRLRDKFVLRFAV

CARTVESAHVQLAWEHISDLASSVLRAEKE - UNI20970 - 

For any suggestions or comments, please send an email to unitrap@crg.es