Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020196 (Cabin1)
Chromosomal location
Chr 10: 75108855 - 75227102 (-)
Description
calcineurin binding protein 1 Gene [Source:MGI Symbol;Acc:MGI:1298375]
RefSeq_dna
NM_172549 
RefSeq_peptide
NP_766137.2 
UniGene
Mm.453198 Mm.257404 
MGI
MGI:1298375 
Uniprot/SPTREMBL
Q3TGB0 Q6PFH4 Q8CGG3 Q3TC43 Q3TDW4 Q6PH97 Q80X22 Q8BIF4 
Human Ortholog
ENSG00000099991 (CABIN1)
Omim not available
UniTrap UNI32738
Vector Insertion
Chr 10: 75218113 - 75227103
Public Clones IST14565C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3981
Vector Insertion
Chr 10: 75214362 - 75216121
Public Clones AR0933 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7870
Vector Insertion
Chr 10: 75200261 - 75200955
Public Clones RRP258 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9641
Vector Insertion
Chr 10: 75157792 - 75162657
Public Clones XG060 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27774
Vector Insertion
Chr 10: 75110967 - 75115619
Public Clones (sanger) IST10884A8 (tigm) IST12043B3 (tigm) IST11703G10 (tigm) IST11552A1 (tigm)
IST14281F7 (tigm) IST14881G12 (tigm) IST11841A3 (tigm) IST13040A1 (tigm)
IST11829C6 (tigm) IST12344B6 (tigm) IST12420G4 (tigm)
Private Clones OST49660 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16343
Vector Insertion
Chr 10: 75109847 - 75110801
Public Clones (ggtc) IST12831A4 (tigm) IST10009G2 (tigm)
Private Clones OST462890 (lexicon) OST448481 (lexicon) OST446882 (lexicon) OST432661 (lexicon)
OST429060 (lexicon) OST426122 (lexicon) OST382220 (lexicon) OST380437 (lexicon)
OST375388 (lexicon) OST324960 (lexicon) OST307671 (lexicon) OST222795 (lexicon)
OST200377 (lexicon) OST191617 (lexicon) OST136442 (lexicon) OST42652 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19350
Vector Insertion
Chr 10: 75109433 - 75109619
Public Clones not available
Private Clones OST393685 (lexicon) OST170597 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092412
Sequence
GGAGTCTGGGAGCTCCGGCCGTTGCCCTGGAGACGCCGGTCGAGTTCCGGGGAGCAAGGGCTGTGTGTGTCTGCTAAGTGTGCGCACGGCTCCCGTGAGC

GCGAGGAGGTGGAACCACGCGAGAAGACCCGCTCTTCCCCTTCCTCCCGGGCGCGGTGGGCCGAAGCCAGGCTCGAGACCCGAAGGCACGGGCGCGGGTC

TTCTGCCCACGCTGGCTTCTTCTCGCTTCCCGCAGCCTCGCCCGGTGGCGCCTAGGGTGGGTCACAGTGACCGCAGCTCGAAGCCATCCCTTTCGGTGCG

TCCTTTCGTTCACCTTCACCGCAGCCCAGCGAG - UNI32738 - GTGGGCCTGAGCACTGTGCCGTTCCGTTCCTGGCTCCTCCTGAACCCTTCTGT

CCTGTTTGCTCTGCAGGGGACTGTCGTGTCCCAGGGATGGGAAGTGATCCTCCGTGGTGGTGCTGAATCTCTGAATATG - UNI32738 - ATTCGAA

TTGCAGCCTTAAATGCCAGCTCCACGATTGAGGATGACCATGAAGGAAGCTTCAAAAGTCACAAAATCCAGACAAAGGAGGCTCAG GAAGCAGAAGCCT

TTGCCCTATACCACAAGGCCCTGGATCTACAAAAACATGACAGGTTCGAGGAGTCCGCCAAGGCCTACCACGAGCTTCTGGAGGCTCGCCTGCTGCGGGA

G GCAGTGTCATCCGGAGATGAGAAGGAAGGGCTGAAACACCCTGGACTGATACTGAAATATTCTACATATAAGAACCTGGCCCAGCTGGCGGCCCAGCG

AGAGGACCTGGAGACCGCCATGGAATTTTATTTGGAG - UNI3981 - GCAGTGATGCTGGATTCCACAGACGTCAACCTTTGGTACAAAATTGGACA

CGTCGCCCTGAGGCTCATCCGGCTTCCCCTGGCTCGCCATGCTTTTGAGGAAGGGCTTCGGTGTAACCCTGACCACTGGCCCTGCCTGGACAATCTCATC

ACTGTTTTGTACACCCTCAGTGATTACACAA CATGTCTTTACTTCATCTGCAAAGCCCTGGAGAAAGACTGCCGGTACAGCAAAGGCCTGGTCCTCAAG

GAGAAGATTTTTGAAGAGCAGCCTTGTCTCCGAAAGGACTCCCTCCGAATGTTTCTCAAGTG TGACATGTCGATTCACGATGTGTCAGTGAGTGCAGCA

GAGACGCAGGCCATTGTAGATGAGGCTCTGGGGCTGCGGAAGAAGAGGCAAGCGTTGATCGTGCGGGAAAAGGAACCAGACCTGAAACTAGTGCAGCCCA

TCCCTTTCTTCAC GTGGAAGTGCCTTGGGGAGAGCTTGCTTGCCATGTACAGTCACCTCACCACCTGTGAGCCCCCGAGGCCCAGCCTTGGGAAGAGGA

TTGACCTGTCTGACTACCAGGATCCCAGCCAGCTGCTAGCATCCTCTGTAGTGGTTACACCTGTCAGTGTGGTCCAGCCAAGTCCTATTTGCACCAATCC

AACTGTTGCCGTGGCTGAGCCTGTGCTCTCCTACACCTCTGTGACCGCAGCTAGCTTCCCACTGCACAGTCCCAGCCTGCTGGACACAGGCACTCCTATG

G GTGATGTTTCTGGAGGAGATAAGTCTAAGAAAGGGGTAAAGCGTAAGAAGACTGTAGAGGAAAGTGGAGAGACAGCAAAGCGGAGGTCTGCCCGGGTC

CGAAACACCAAGTGCAAAAAAGAAGAGAAAGTGGATTTCCAGGGACTGCTAGTAAAGTTCCTGCCGTCCAG GTTAAGAAAACTGGACCCTGAGGAGGAA

GATGATCCATTTAATAACTATGAAGTTCAGGCAGAAGCCAAACTGGAGAGCTTCTCCAATGTGGGACCTCATCGCCTGTCCTTCGACTCAGCCACATTCA

TGGAATCTG AGAAGCAGGATGTGCATGCGTTCCTGATGGAGAACCTGACCAACGGGGGCCTCCTGGAGCTTATGATGCGTTATCTGAAGAGCATGGGCC

ACAAGTTCCTGCTCAAGTGGCCCCCAGGGCTGGCGGATGTCGTCCTTAGCGTTTACCACAGCTGGAGGAGGCATAGCACCAGCCTGCCCAACCCATTGCT

GAGGGACTGCAGCAACAAGCACATCAAG GACATGATGCTGATGTCTCTCTCCTGCATGGAGCTCCAACTGGACCAGTGGTTACTGACCAAAGGCAGAAG

CTCCGCAG TGTCTCCCCGGAACTGCCCTGCTGGTGTGGTGACAGGCAGGTTTGGGCCTGACTTCCCGGGCACCCACTGCCTGGGTGACCTCCTGCAGCT

GTCATTTGCATCATCTCAGCGGGACCTGTTTGAGGATGGCTGGCTGGAGTTTGTTGTCCGTGTTTACTGGCTGAAGGCACGTTTCTTGGCACTACAG GG

AGACATGGAACAAGCCTTGGAGAACTATGATATCTGCACAGAAATACTGCAGAGCTCCAGTGCTATCCAAGCCCAGGCAGGGGCTGAGCAAGGGGACATA

GTCATCCGGCTGCCCAACCTTCACAATGACTCCGTTGTCTCTCTGGAGGAA - UNI7870 - ATTGATAAGAACCTGAAGTCTCTGGAAAGGTGCCAG

TCCCTGGAGGAGATCCAGCGGCTGTTTGAGGCAGGTGACTACAAGGCTGTGGTGCATCTGCTCCGGCCCACTTTGTGTACCAGTGGGTTTGACCGAGCCA

AACACCTGGAGTTTATGACGTCCATTCCTGAGAGGCCAGCCCAGCTGCTTCTGCTGCAG GACTCATTGCTGCGGCTGAAGGACCACAGACAGTGTTTTG

AATGTTCTGATGTGGCTCTGAATGAAGCTGTCCAGCAGATGCTGAACTCAAGTGAATCTGCAGCCAAGGAAGAGTGGGTGGCCACAGTGACCCAACTGCT

GCTAGGCATCGAGCAAGCACTGTCGTCAGACAGCAGTGGCAGTATCCTTAAGGAGTCATCCTCGACCACTGGCCTTGTCCGCCTCACCAACAACCTCATT

CAG GTCATCGACTGCAGCATGGCTGTGCAAGAGGAGCCCAAGGAACCCTATGTCTCCTCCGTGCTGCCCTGGATCATCCTGCACAGGATCATCTGGCAG

GAGGAAGACACTTTCCGCTCCCTGTGCCACCAGCAGCAGCTCCAGAACCCAACAGAAGAAG GGATACCGGAGATGCCCATGCTCCCATCTTCCCTCATG

CTACTCAACACAGCACATGAGTACCTGGGCAGGAGGTCCTGGTGCTGCAATTCAGATGGAGCTCTGCTGCGATTCTAT GTGCAAGTTCTCCAAAAGGAG

CTTGCTGCGTCAGCCTCTGAAGACACTCACCCCTACAAGGAGGAGCTGGAGACTGCCTTGGAGCAGTGTTTCTACTGCCTGTACAGCTTCCCCAGCAAGA

AGAGCAAGGCCAGGTACCTGGAGGAACACTCAGCCCAGCAG GTGGATCTTATATGGGAGGATGCCCTGTTTATGTTTGAGTATTTTAAGCCCAAGACCC

TCCCTGAATTTGATAGCTACAAGACAAGCACTGTTTCTGCTGACTTGGCAAACCTGTTGAAGAGAATTGCTACCATTGTGCCCCGCACAGAGAAGCCAG 

TTTTTCCCCTGTGCGTTTTTTGTT CCTGCTGCTTTTTTTTT
Translation
 - UNI32738 - M - UNI32738 - IRIAALNASSTIEDDHEGSFKSHKIQTKEAQ EAEAFALYHKALDLQKHDRFEESAKAYHELLEARLLRE 

AVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLE - UNI3981 - AVMLDSTDVNLWYKIGHVALRLIRLPLARHAFEEGLRCNPDH

WPCLDNLITVLYTLSDYTT TCLYFICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKC CDMSIHDVSVSAAETQAIVDEALGLRKKRQALIVR

EKEPDLKLVQPIPFFT TWKCLGESLLAMYSHLTTCEPPRPSLGKRIDLSDYQDPSQLLASSVVVTPVSVVQPSPICTNPTVAVAEPVLSYTSVTAASFP

LHSPSLLDTGTPMG GDVSGGDKSKKGVKRKKTVEESGETAKRRSARVRNTKCKKEEKVDFQGLLVKFLPSR RLRKLDPEEEDDPFNNYEVQAEAKLES

FSNVGPHRLSFDSATFMESE EKQDVHAFLMENLTNGGLLELMMRYLKSMGHKFLLKWPPGLADVVLSVYHSWRRHSTSLPNPLLRDCSNKHIK DMMLM

SLSCMELQLDQWLLTKGRSSAV VSPRNCPAGVVTGRFGPDFPGTHCLGDLLQLSFASSQRDLFEDGWLEFVVRVYWLKARFLALQ GDMEQALENYDIC

TEILQSSSAIQAQAGAEQGDIVIRLPNLHNDSVVSLEE - UNI7870 - IDKNLKSLERCQSLEEIQRLFEAGDYKAVVHLLRPTLCTSGFDRAKHLE

FMTSIPERPAQLLLLQ DSLLRLKDHRQCFECSDVALNEAVQQMLNSSESAAKEEWVATVTQLLLGIEQALSSDSSGSILKESSSTTGLVRLTNNLIQ V

IDCSMAVQEEPKEPYVSSVLPWIILHRIIWQEEDTFRSLCHQQQLQNPTEEG GIPEMPMLPSSLMLLNTAHEYLGRRSWCCNSDGALLRFY VQVLQKE

LAASASEDTHPYKEELETALEQCFYCLYSFPSKKSKARYLEEHSAQQ VDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTEKP

V VFPLCVFCS SCCFFF
Transcript ENSMUST00000001712
Sequence
GGAGTCTGGGAGCTCCGGCCGTTGCCCTGGAGACGCCGGTCGAGTTCCGGGGAGCAAGGGCTGTGTGTGTCTGCTAAGTGTGCGCACGGCTCCCGTGAGC

GCGAGGAGGTGGAACCACGCGAGAAGACCCGCTCTTCCCCTTCCTCCCGGGCGCGGTGGGCCGAAGCCAGGCTCGAGACCCGAAGGCACGGGCGCGGGTC

TTCTGCCCACGCTGGCTTCTTCTCGCTTCCCGCAGCCTCGCCCGGTGGCGCCTAGGGTGGGTCACAGTGACCGCAGCTCGAAGCCATCCCTTTCGGTGCG

TCCTTTCGTTCACCTTCACCGCAGCCCAGCGAG - UNI32738 - GTGGGCCTGAGCACTGTGCCGTTCCGTTCCTGGCTCCTCCTGAACCCTTCTGT

CCTGTTTGCTCTGCAGGGGACTGTCGTGTCCCAGGGATGGGAAGTGATCCTCCGTGGTGGTGCTGAATCTCTGAATATG - UNI32738 - ATTCGAA

TTGCAGCCTTAAATGCCAGCTCCACGATTGAGGATGACCATGAAGGAAGCTTCAAAAGTCACAAAATCCAGACAAAGGAGGCTCAG GAAGCAGAAGCCT

TTGCCCTATACCACAAGGCCCTGGATCTACAAAAACATGACAGGTTCGAGGAGTCCGCCAAGGCCTACCACGAGCTTCTGGAGGCTCGCCTGCTGCGGGA

G GCAGTGTCATCCGGAGATGAGAAGGAAGGGCTGAAACACCCTGGACTGATACTGAAATATTCTACATATAAGAACCTGGCCCAGCTGGCGGCCCAGCG

AGAGGACCTGGAGACCGCCATGGAATTTTATTTGGAG - UNI3981 - GCAGTGATGCTGGATTCCACAGACGTCAACCTTTGGTACAAAATTGGACA

CGTCGCCCTGAGGCTCATCCGGCTTCCCCTGGCTCGCCATGCTTTTGAGGAAGGGCTTCGGTGTAACCCTGACCACTGGCCCTGCCTGGACAATCTCATC

ACTGTTTTGTACACCCTCAGTGATTACACAA CATGTCTTTACTTCATCTGCAAAGCCCTGGAGAAAGACTGCCGGTACAGCAAAGGCCTGGTCCTCAAG

GAGAAGATTTTTGAAGAGCAGCCTTGTCTCCGAAAGGACTCCCTCCGAATGTTTCTCAAGTG TGACATGTCGATTCACGATGTGTCAGTGAGTGCAGCA

GAGACGCAGGCCATTGTAGATGAGGCTCTGGGGCTGCGGAAGAAGAGGCAAGCGTTGATCGTGCGGGAAAAGGAACCAGACCTGAAACTAGTGCAGCCCA

TCCCTTTCTTCAC GTGGAAGTGCCTTGGGGAGAGCTTGCTTGCCATGTACAGTCACCTCACCACCTGTGAGCCCCCGAGGCCCAGCCTTGGGAAGAGGA

TTGACCTGTCTGACTACCAGGATCCCAGCCAGCTGCTAGCATCCTCTGTAGTGGTTACACCTGTCAGTGTGGTCCAGCCAAGTCCTATTTGCACCAATCC

AACTGTTGCCGTGGCTGAGCCTGTGCTCTCCTACACCTCTGTGACCGCAGCTAGCTTCCCACTGCACAGTCCCAGCCTGCTGGACACAGGCACTCCTATG

G GTGATGTTTCTGGAGGAGATAAGTCTAAGAAAGGGGTAAAGCGTAAGAAGACTGTAGAGGAAAGTGGAGAGACAGCAAAGCGGAGGTCTGCCCGGGTC

CGAAACACCAAGTGCAAAAAAGAAGAGAAAGTGGATTTCCAGGGACTGCTAGTAAAGTTCCTGCCGTCCAG GTTAAGAAAACTGGACCCTGAGGAGGAA

GATGATCCATTTAATAACTATGAAGTTCAGGCAGAAGCCAAACTGGAGAGCTTCTCCAATGTGGGACCTCATCGCCTGTCCTTCGACTCAGCCACATTCA

TGGAATCTG AGAAGCAGGATGTGCATGCGTTCCTGATGGAGAACCTGACCAACGGGGGCCTCCTGGAGCTTATGATGCGTTATCTGAAGAGCATGGGCC

ACAAGTTCCTGCTCAAGTGGCCCCCAGGGCTGGCGGATGTCGTCCTTAGCGTTTACCACAGCTGGAGGAGGCATAGCACCAGCCTGCCCAACCCATTGCT

GAGGGACTGCAGCAACAAGCACATCAAG GACATGATGCTGATGTCTCTCTCCTGCATGGAGCTCCAACTGGACCAGTGGTTACTGACCAAAGGCAGAAG

CTCCGCAG TGTCTCCCCGGAACTGCCCTGCTGGTGTGGTGACAGGCAGGTTTGGGCCTGACTTCCCGGGCACCCACTGCCTGGGTGACCTCCTGCAGCT

GTCATTTGCATCATCTCAGCGGGACCTGTTTGAGGATGGCTGGCTGGAGTTTGTTGTCCGTGTTTACTGGCTGAAGGCACGTTTCTTGGCACTACAG GG

AGACATGGAACAAGCCTTGGAGAACTATGATATCTGCACAGAAATACTGCAGAGCTCCAGTGCTATCCAAGCCCAGGCAGGGGCTGAGCAAGGGGACATA

GTCATCCGGCTGCCCAACCTTCACAATGACTCCGTTGTCTCTCTGGAGGAA - UNI7870 - ATTGATAAGAACCTGAAGTCTCTGGAAAGGTGCCAG

TCCCTGGAGGAGATCCAGCGGCTGTTTGAGGCAGGTGACTACAAGGCTGTGGTGCATCTGCTCCGGCCCACTTTGTGTACCAGTGGGTTTGACCGAGCCA

AACACCTGGAGTTTATGACGTCCATTCCTGAGAGGCCAGCCCAGCTGCTTCTGCTGCAG GACTCATTGCTGCGGCTGAAGGACCACAGACAGTGTTTTG

AATGTTCTGATGTGGCTCTGAATGAAGCTGTCCAGCAGATGCTGAACTCAAGTGAATCTGCAGCCAAGGAAGAGTGGGTGGCCACAGTGACCCAACTGCT

GCTAGGCATCGAGCAAGCACTGTCGTCAGACAGCAGTGGCAGTATCCTTAAGGAGTCATCCTCGACCACTGGCCTTGTCCGCCTCACCAACAACCTCATT

CAG GTCATCGACTGCAGCATGGCTGTGCAAGAGGAGCCCAAGGAACCCTATGTCTCCTCCGTGCTGCCCTGGATCATCCTGCACAGGATCATCTGGCAG

GAGGAAGACACTTTCCGCTCCCTGTGCCACCAGCAGCAGCTCCAGAACCCAACAGAAGAAG GGATACCGGAGATGCCCATGCTCCCATCTTCCCTCATG

CTACTCAACACAGCACATGAGTACCTGGGCAGGAGGTCCTGGTGCTGCAATTCAGATGGAGCTCTGCTGCGATTCTAT GTGCAAGTTCTCCAAAAGGAG

CTTGCTGCGTCAGCCTCTGAAGACACTCACCCCTACAAGGAGGAGCTGGAGACTGCCTTGGAGCAGTGTTTCTACTGCCTGTACAGCTTCCCCAGCAAGA

AGAGCAAGGCCAGGTACCTGGAGGAACACTCAGCCCAGCAG GTGGATCTTATATGGGAGGATGCCCTGTTTATGTTTGAGTATTTTAAGCCCAAGACCC

TCCCTGAATTTGATAGCTACAAGACAAGCACTGTTTCTGCTGACTTGGCAAACCTGTTGAAGAGAATTGCTACCATTGTGCCCCGCACAGAGAAGCCAGC

TCTGAGCATGGACAAAGTCTCTGCCTACATTGAGGGAACCTCAGCTGAG GCGCCCTGCCTTCCAGAAGGAGCGGACCCCACCCCTCCCGTGCTGAATGA

GCTCTACTACCTCCTGGCTGACTACCATTTCAAGAACAAGGAGCAGTCTAAAGCCATCAAGTTCTACATGCATGACATCTGCATCTGCCCTAACAG GTT

TGACTCCTGGGCGGGAATGGCTCTGGCCCGGGCCAGCCGAATTCAGGACAAGCTGAACTCAAATGAGCTGAAGAGTGATGGGCCCATCTGGAAACATGCC

ACACCTGTTCTCAACTGCTTCCGGAGGGCCCTTGAGATTGACAGCTCTAATTTGTCCTTGTGGATTGAGTATGGTACCATGTCCTATGCCTTACACTCTT

TCGCATCCCGTCAGCTGAAGCAGTGGAGAAGTGAGCTGCCCCCGGAGCTTGTGCAGCAG ATGGAGGATCGGCGAGACAGCATGCTGGAGACAGCCAGGC

ACTGTTTCACGTCTGCAGCCCGCTGTGAGGGCGATGGTGATGAGGAGGAGTGGCTCATTCACTACATGCTGGGCAAGGTGGCTGAGAAGCAGCAGCAGCC

GCCAACTGTGTACCTGCTGCACTACCGGCAGGCTGGCCACTACTTACACGAGGAGGCTGCCCGGTACCCGAAGAAGATTCACTACCACAACCCACCTGAG

CTGGCCATGGAAGCCCTGGAG GTGTACTTCCGGCTCCATGCGTCCATCCTGAAGCTCCTGGGCAAACCTGACTCTGGGGTTGGTGCAGAGGTCCTGGTC

AGCTTTATGAAGGAGGCAGCAGAAGGACCTTTTGCCAGGGGCGAGGAGAAGAATACGCCCAAAGCTTCAGAAAA GGAGAAGGCCTGCCTGGTGGATGAG

GACTCCCACTCTTCAGCTGGGACACTGCCGGGCCCCGGAGCCTCCCTTCCCTCCTCCTCTGGCCCAGGTCTGACATCCCCACCTTACACAGCCACTCCGA

TTGACCACGATTACGTCAAATGTAAAAAACCCCATCAGCAGGCGGCGCCGGACG ACCGAAGCCAGGACAGCACAGCTGTGGCACTGTCAGACTCCAGCT

CAACACAGGACTTCTTTAATGAGCCCACAAGTTTGCTGGAAGGTTCTCGAAAGCTCTTTCCAGAGAAGAGGCTGTCTGGGCTCAGTGCTCAAGCAGGACC

AAGTGGTAAAGATCTTCCGGGGCCCACAGAAGAAAGAG - UNI9641 - GAAAAACAGAAGAGTCCTTGGAGAGCACAGAGGCCTTCCGGGTTGTAGA

ACAAAGCGTCCAGAAGCCTGTGGCAGACTCCTCAGCCTCTGCTTACATCCCCAGCAAGCCCCCAGCGTCCACACCTCCTTTGTGGGATGGGAAGAAGAGG

GGTGATTCCCTAGGGGAGCCGGTGGCTTTTCCCCAGGGGCTGCCAGCGGGTGCTGAGGAGCAGCGCCAGTTCCTTACAGAGCAGTGCATCTCCTCCTTCT

GCCTGTGCTTGAGCCGCTTCCCACAGCACTACAAGAGTCTCTACCGGCTGGCCTTCCTCTACACCTACAGCAAGACTCACCGG AACCTCCAGTGGGCCC

GTGATGTGTTGCTAGGCAGCAGTATCCCATGGCAACAGCTGCAGCACATGCCGGCACAGGGGCTCTTCTGCGAGAGGAACAAGACCAATTTCTTCAAC G

GCATCTGGCGGATCCCCGTGGATGAGATTGACCGGCCAGGCAGCTTTGCCTGGCACATGAACCGCTCCATCGTGCTGCTGCTCAAGGTTCTAGCCCAGCT

CCGCGACCACAGCACCCTGTTGAAGGTGTCCTCCATGCTGCAGCGGACACCAGACCAGGGCAA GAAATATCTGCGAGATGCTGACCGCCAGGTCCTGGC

ACAGCGCGCCTTCATCCTCACTGTGAAAGTGTTGGAGGACACACTGAGTGAGCTTGCAGAG GGGTCAGAACACCCAGGATCCAAGGCCTGCGGCCTCTC

TGGAGCCAGGATGACCACTGATGTCTCGCACAAAGCCAGTCCCGAGGATGGCCAGGAAAGCCCCCAACACCCCAAGAAGCTACCTCTAGCTGATGGCTCA

GGACCAGGGCCTGAGCCAGGGGGCAGGATGGGCCCTCTTAACCAATTGCCAGTGGTCACAGACATAAGGGACAACACAGACCAGGGTGGGGAGCAGAAAG

ACAAAGAGAGTCCCCAGGTGGGGCCCACTGAACCCATGGATACCAGTGAGGCTGCTGGTCGCCACTCAGACTTGGAACAGACATCACGTCTGTTGCCGGG

CCGCCCCCCAAGGGACCGGGGCCCTGAGAGCCGGTCTGCTGAGCTTTCCTTAGAGGAGCTGAGTATCAGCACCCGGCAACAGCCCGCTCCACTGGCCCCA

TCCCCAGCAGCCCCCACCACAACTGCTGCTCCCACTACCATGGCGGCCAGGGGAGCGGGGCACTCTGAGGAGGCACCTCCAAGGCCTAATCGGAAAAGGA

AACTCCTGGAGGACACGGAGTCTGGCAAGACTCTCCTACTGGATGCCTACCGTGTGTGGCAGCAGGGCCAGAAGGGCATGGCCTATGACCTGAGCCGCAT

CGAGAAGATCATGTCGGAGACTTACATGCTCATCAAGCAG GTGGATGAGGAGACTGCACTGGAGCAGGCTGTGAAGTTCTGTCAGGTCCACCTTGGGGC

CGCTACCCAGAGACAG GCCTCAGGAGATACGCCCACTACCCCCAAGCACCCCAAGGACAGCAGAGAGAATTTCTTCCCTGCAACAGTGGTCCCCACGGT

ACCTGACCCCACAGCACCTGATGCTCTCCAGAGGCCCAGTGACTCCCACCTCAAGCCTGTATTGGCTACTGTCATCACCTGCCCTCCCTCAGCTTCAGCC

TCTATCCCAGACCTATCCACAGATCCTGGAATTCCCCGGCCACACAGGCCAGAGACTACCCCCAGCAGGGCCCCTTTAAGTCCTG - UNI27774 - A

GGGAGAAGAGGCATCAGGAGTGACGGAGGGCACCAGCATTCTACCCCAAGAACCACGCTACAGTCACCAGATAAAAATGGCTGCCACAGGTCACCTGGCT

GAGCAACACTGCTGGCCAGTGGAGGTTGCTTGCCAGACAGGAGCTGAGCCCACCTGCAGCCAAG - UNI16343 - CCTCCAGCACTAAGGTCCCCAG

CAGTGGAAGTACTCAGACGGCTGAGAGCCATCAAGGCAAAACTGAGTCCAGCAGGGCCAAATCCCGCCTCCTGCCCAACATGCCAAAGCTGGTGATCCCC

TCGGCCACCACCAAGTCCCCTCCTGAGATCACCGTCACACCACCTACCCCTACCCTGCTTTCCCCCAAAGGCAGCATCTCGGAGGAGACCAAGCAGAAGC

TGAAG - UNI19350 - TCAGCCATCCTGTCTGCCCAATCCGCTGCCAATGTGAGGAAGGAGAGCCTGTGCCAGCCAGCCCTGGAGGTTCTGGAGACA

TCCAGCCAGGAGTCCTCACTGGAGAGCGAGACAGACGAGGATGATGACTTCATGGACGTATGAAGGAGTCCACCCAGAGGCCTGCAGCCATAGCAGGGCA

ACAGCAAGGCCTGGGATCCCTTTGTCCAGACCCTGGGCAAGGCCAGAAGCCTATGTGAGGTAGCGTGTCCTGTGGTCTCCTAAGCTGCCCAGCCCCCTCT

TTACAGCACCCTGCCTGGGTCCAGGCTGTCCACACATTGTGTTGGTCCAGAGGAAGATAAGGCCTGTCTTAGGCACGTACGTGCACTGGCTGTGTTTTGC

GCAGTAGGGATGGCACTTCTTTTTGTAATGAAATACTGACTTTCTTTCCAAGCCCATGTCCGGCTGATCAGGCCCACAGCCGAGTGCCCAGGGAGGCCAG

CTTGGGTTCTGGTAGAGACATTATCAGGAGCCCAGCTCACCCCACACCCTTTTTTTGTCATTGTTGCTTCTTTTTCTAATAAAGGTGGAAAATAGTC
Translation
 - UNI32738 - M - UNI32738 - IRIAALNASSTIEDDHEGSFKSHKIQTKEAQ EAEAFALYHKALDLQKHDRFEESAKAYHELLEARLLRE 

AVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLE - UNI3981 - AVMLDSTDVNLWYKIGHVALRLIRLPLARHAFEEGLRCNPDH

WPCLDNLITVLYTLSDYTT TCLYFICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKC CDMSIHDVSVSAAETQAIVDEALGLRKKRQALIVR

EKEPDLKLVQPIPFFT TWKCLGESLLAMYSHLTTCEPPRPSLGKRIDLSDYQDPSQLLASSVVVTPVSVVQPSPICTNPTVAVAEPVLSYTSVTAASFP

LHSPSLLDTGTPMG GDVSGGDKSKKGVKRKKTVEESGETAKRRSARVRNTKCKKEEKVDFQGLLVKFLPSR RLRKLDPEEEDDPFNNYEVQAEAKLES

FSNVGPHRLSFDSATFMESE EKQDVHAFLMENLTNGGLLELMMRYLKSMGHKFLLKWPPGLADVVLSVYHSWRRHSTSLPNPLLRDCSNKHIK DMMLM

SLSCMELQLDQWLLTKGRSSAV VSPRNCPAGVVTGRFGPDFPGTHCLGDLLQLSFASSQRDLFEDGWLEFVVRVYWLKARFLALQ GDMEQALENYDIC

TEILQSSSAIQAQAGAEQGDIVIRLPNLHNDSVVSLEE - UNI7870 - IDKNLKSLERCQSLEEIQRLFEAGDYKAVVHLLRPTLCTSGFDRAKHLE

FMTSIPERPAQLLLLQ DSLLRLKDHRQCFECSDVALNEAVQQMLNSSESAAKEEWVATVTQLLLGIEQALSSDSSGSILKESSSTTGLVRLTNNLIQ V

IDCSMAVQEEPKEPYVSSVLPWIILHRIIWQEEDTFRSLCHQQQLQNPTEEG GIPEMPMLPSSLMLLNTAHEYLGRRSWCCNSDGALLRFY VQVLQKE

LAASASEDTHPYKEELETALEQCFYCLYSFPSKKSKARYLEEHSAQQ VDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTEKP

ALSMDKVSAYIEGTSAE APCLPEGADPTPPVLNELYYLLADYHFKNKEQSKAIKFYMHDICICPNR RFDSWAGMALARASRIQDKLNSNELKSDGPIW

KHATPVLNCFRRALEIDSSNLSLWIEYGTMSYALHSFASRQLKQWRSELPPELVQQ MEDRRDSMLETARHCFTSAARCEGDGDEEEWLIHYMLGKVAEK

QQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEALE VYFRLHASILKLLGKPDSGVGAEVLVSFMKEAAEGPFARGEEKNTPKASEK KEK

ACLVDEDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQAAPDD DRSQDSTAVALSDSSSTQDFFNEPTSLLEGSRKLFPEKRLS

GLSAQAGPSGKDLPGPTEERG - UNI9641 - GKTEESLESTEAFRVVEQSVQKPVADSSASAYIPSKPPASTPPLWDGKKRGDSLGEPVAFPQGLPA

GAEEQRQFLTEQCISSFCLCLSRFPQHYKSLYRLAFLYTYSKTHR NLQWARDVLLGSSIPWQQLQHMPAQGLFCERNKTNFFN GIWRIPVDEIDRPGS

FAWHMNRSIVLLLKVLAQLRDHSTLLKVSSMLQRTPDQGK KKYLRDADRQVLAQRAFILTVKVLEDTLSELAE GSEHPGSKACGLSGARMTTDVSHKA

SPEDGQESPQHPKKLPLADGSGPGPEPGGRMGPLNQLPVVTDIRDNTDQGGEQKDKESPQVGPTEPMDTSEAAGRHSDLEQTSRLLPGRPPRDRGPESRS

AELSLEELSISTRQQPAPLAPSPAAPTTTAAPTTMAARGAGHSEEAPPRPNRKRKLLEDTESGKTLLLDAYRVWQQGQKGMAYDLSRIEKIMSETYMLIK

Q VDEETALEQAVKFCQVHLGAATQRQ ASGDTPTTPKHPKDSRENFFPATVVPTVPDPTAPDALQRPSDSHLKPVLATVITCPPSASASIPDLSTDPGI

PRPHRPETTPSRAPLSPE - UNI27774 - EGEEASGVTEGTSILPQEPRYSHQIKMAATGHLAEQHCWPVEVACQTGAEPTCSQA - UNI16343 

- ASSTKVPSSGSTQTAESHQGKTESSRAKSRLLPNMPKLVIPSATTKSPPEITVTPPTPTLLSPKGSISEETKQKLK - UNI19350 - SAILSAQS

AANVRKESLCQPALEVLETSSQESSLESETDEDDDFMDV

For any suggestions or comments, please send an email to unitrap@crg.es