Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020226 (Slc5a4b)
Chromosomal location
Chr 10: 75520239 - 75573706 (-)
Description
solute carrier family 5 (neutral amino acid transporters, system A), member 4b Gene [Source:MGI (curated);Acc:Slc5a4b-001]
RefSeq_peptide
NP_075708.2 
UniGene
Mm.155678 
MGI
MGI:1890478 
Uniprot/SPTREMBL
Q9ET36 A0PJT9 Q2VPB3 Q3UNC8 Q91ZP4 Q9CR07 
Human Ortholog
not available
Omim not available
UniTrap UNI32727
Vector Insertion
Chr 10: 75553423 - 75566674
Public Clones IST10256G1 (tigm) IST14820H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32919
Vector Insertion
Chr 10: 75520238 - 75523200
Public Clones CMHD-GT_234F3-3 (cmhd) IST14990A1 (tigm) IST11922C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099573
Sequence
GAAAGGACCAGAACCTCCTGAAGCCATGGCTAGCACCTTAAGTCCCAGCATCACGCCTCAGACTGAGGAGCCTCCTGTAGTGCCAGTGCGCATTCAGAAT

GCTGCTGACATCTCTGTCATCGTCATCTACTTCATAGTGGTGCTAGCTGTGGGGCTGTGG TCAATGGTGAGAAGCAACCGTGGCACTGTTGGAGGCTTC

TTCCTGGCTGGTCATGACATGGCCTGGTGGCCG ATGGGTGCCTCTCTCTTTGCCAGTAACATTGGCAGCAATCACTTCGTGGGCTTGGCTGGAACAGGA

GCGGCTTCAGGAATCGCTATTGCAGCTGTGGAATGGAAT GCCCTGCTTATGGTGCTGGTTCTTGGTTGGGTGTTTCTCCCCATCTACATCAAGGCTGGG

 - UNI32727 - GTGTTGACCATGCCAGAGTATCTCAGGAAGCGCTTCGGTGGGAAGAGACTGCAGATCTACCTTTCTGTCCTCTCCCTCTTCATCAT

GGTGGCCCTTCAAACTTCC - UNI32727 - TCAATCATATTTTCCGGAGCCATATTCATTCAATTGGCCTTGGGATTGAACCTCTACCTGGCTGTCT

TCATCCTATTGGCTATCACTGCTTTTTACACGGTGGCTG - UNI32727 - GGGGTTTGGCCTCAGTGATCTACACAGACTCTGTGCAGACTTTCATC

ATGCTGCTTGGCTCCTTAATTCTCATGGGGTTTG CATTTGCTGAAGTCGGAGGCTACGAGAGCTTTACCGAGAAGTATATGAATGCCATCCCCTCTGTA

GTGGAGGGGGACAACCTGACCATCAGCCCCAAGTGCTACACTCCTCAGCCCGACTCCTTCCACGTCTTCCGAGATCCAGTCACTGGAGACATTCCATGGC

CGGGACTGATATTTGGAATGACCATTTTAGCCATCTGGTACTGGTGTGCCGATCAG GTCATCGTACAGCGCTGCTTATGTGGTAAGAACATGTCCCACG

TGAAGGCCGCCTGCATCCTGTGTGGTTACCTGAAGCTGCTGCCCATGTTCCTCATGGTGATGCCGGGCATGATCAGCCGCATTCTGTACACAG CAGATA

AGGTGGCCTGCGTTGTACCTTCTGAGTGTGAGAAACAGTGTGGCACTGCGGTCGGCTGCACCAACTATGCCTACCCCACCCTGGTGCTGGAGTTGATGCC

TGATG GACTGCGAGGCCTGATGCTGTCAGTCATGCTGGCTTCTCTCATGAGCTCTCTGACCTCCATCTTCAACAGCGCCAGCACCCTCTTCACCATCGA

CCTGTACACCAAGATAAGGAAGAAGGCATCAGAGAGAGAGCTCATGATAGCCGGACG GATATTTGGCATGGTCCTAATCGCCGTCAGCATCCTGTGGGT

CCCACTGGTCCAGGTGTCACAGAATGGACAGCTCTTCCACTATATTGGCTCAGTTTCTAGCTACCTTGGGCCTCCCCTTGGTGCAGTCTTCATGCTTGCT

ATCTTCTTCAAAAGGGTCAATGAGCAG GGAGCATTCTGGGGGCTAATGGTCGGACTTGTGGTAGGCCTTATTCGCCTGATCGCTGAGTTTGTATACGGA

ACAGGCAGCTGCGTGGCTCCCAGTAACTGTCCCAAGATTATCTGTGGAGTGCACTATATGTACTTTGCCATCATACTCTTCTTTGTGTCCATAATAGTAA

TCCTGGGAGTCTCCTTCCTAACGGAGCCGATTCCTGATGTTCAC - UNI32919 - CTGTACCGCCTATGCTGGAGTCTTTGGAACAACACAGAGGAG

CGGATAGACTTGGATGCAGAAGAATTGGAAACTCAAGAAGAAGCTGGTGGTGCTCTTGAAGAA - UNI32919 - ATTCTGAGCAATCCCGTGGCTGT

CTCAAGAGGGCATGCTGCTTATTGTGTGGTTTGCAGAATACAGGGCCCAAGCTGACCAAAGAAGAGGAGGCAGCTCTGAGGCAGAAGTTCTCAGACACAT

CTGAGAAGCCCTTGTGGAGAACCGTCATGAACATCAATGCCGTCCTCCTCCTGGGTGTGGCTGTCTTTGTCCATGCCTATTTTGCCTGAACCCTGAAGGA

AGCAGAAACTATTTGTACTGAGTTTTCTTTTATAAAGTTGGCTGTGTAACAAAGGTAAATGACCGGGAAATGTTTGTGCTTAGATTGCTATACACATGAT

TTCTTGCTTTTATCATACCCTTGTGATTAGTTTAAAAATTCTTAAACTCGAGGAGCAGTGGTGGCACATGCCTTTAGTCCCAGCACTTGGGAGGCAGAGG

CAGGCAGATTTCTGAGTTCAAGGCCAGCCTGGTCTACAAAGTGAGTTCCACGACAGCCAGGGCTACACAAAGAAACCCTGTCTCGAAAAACAAAAACAAC

AACAACAAAAAATTCTTAAACTCTATTTAGATATAAACGGCAATGTATATATATATTTTAAGATATACACCATGGTGATTTGATATGTACACACTTTGAA

ATGATTATCATGGTCAATTTAATAGACTCATCATTTGATTTGGTCATCCTCTATGTGTTTATGGTGACAGTATTTGACATGTGCTCACCTAGTAAATTTC

AGTTATACAACAGATTTTTTTTTAAAGTGTGGTCACCATAATTTACATGGGTCCCCAGAATTCTTTTTTTAATCCAAAATTTTATGCCCTTTGATCAACA

TCTATTTCAAAACTTGCAATGGATAACTCAGTATTCATTAGCTACGATGTGACATCTCGATGAATGAGGAATTTTAGTCCTCAGAGTGATTCTTACAAGA

AGATTCAGGATTTGTGTTCAGCTGACGAATTAATCTCTCGGGCAGCCATCGCGCTCCATCTTCTTCTCGTGAAAAAACACAGACCGAGTCCCTTCCCCAG

ATTATAACCAGATCTGAACCCTTCCATTTGTTAGTTAGTGGGTCCTTCCATTTTACCAATGCATAAGAATTAGAGGTAACTGGATGCCAGTGGCGATCCG

CTGCAGACTGACCTTCAATATCAGTTTGCAAAAAATTTAGAACAAATAAAGCAAAGGCAAGATGTGCCTTTGGTGACCTTGGGGGATATAACTGCCCCTG

TTTTGTCTTAAAAAGCCATTTTTTTAAGGTGCGAAGAGCACGTTCAACTATTCCTTGTCCTATGGGGTTATAAGGAATTCAGTTTTATGTTTGTTCAACT

ATTCCTTGTCCTATGGGGTTATAAGGAATTCAGTTTTATGTTTGATACCAAATTTCTTACAGAATGAAATAAAATTTTTACT
Translation
MASTLSPSITPQTEEPPVVPVRIQNAADISVIVIYFIVVLAVGLW SMVRSNRGTVGGFFLAGHDMAWWP MGASLFASNIGSNHFVGLAGTGAASGIAI

AAVEWN ALLMVLVLGWVFLPIYIKAG - UNI32727 - VLTMPEYLRKRFGGKRLQIYLSVLSLFIMVALQTS - UNI32727 - SIIFSGAIFI

QLALGLNLYLAVFILLAITAFYTVAG - UNI32727 - GGLASVIYTDSVQTFIMLLGSLILMGFA AFAEVGGYESFTEKYMNAIPSVVEGDNLTIS

PKCYTPQPDSFHVFRDPVTGDIPWPGLIFGMTILAIWYWCADQ VIVQRCLCGKNMSHVKAACILCGYLKLLPMFLMVMPGMISRILYTA ADKVACVVP

SECEKQCGTAVGCTNYAYPTLVLELMPDG GLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKIRKKASERELMIAGR RIFGMVLIAVSILWVPLV

QVSQNGQLFHYIGSVSSYLGPPLGAVFMLAIFFKRVNEQ GAFWGLMVGLVVGLIRLIAEFVYGTGSCVAPSNCPKIICGVHYMYFAIILFFVSIIVILG

VSFLTEPIPDVH - UNI32919 - LYRLCWSLWNNTEERIDLDAEELETQEEAGGALEE - UNI32919 - ILSNPVAVSRGHAAYCVVCRIQGPS

Transcript ENSMUST00000120757
Sequence
GAAAGGACCAGAACCTCCTGAAGCCATGGCTAGCACCTTAAGTCCCAGCATCACGCCTCAGACTGAGGAGCCTCCTGTAGTGCCAGTGCGCATTCAGAAT

GCTGCTGACATCTCTGTCATCGTCATCTACTTCATAGTGGTGCTAGCTGTGGGGCTGTGG TCAATGGTGAGAAGCAACCGTGGCACTGTTGGAGGCTTC

TTCCTGGCTGGTCATGACATGGCCTGGTGGCCG ATGGGTGCCTCTCTCTTTGCCAGTAACATTGGCAGCAATCACTTCGTGGGCTTGGCTGGAACAGGA

GCGGCTTCAGGAATCGCTATTGCAGCTGTGGAATGGAAT GCCCTGCTTATGGTGCTGGTTCTTGGTTGGGTGTTTCTCCCCATCTACATCAAGGCTGGG

 - UNI32727 - GTGTTGACCATGCCAGAGTATCTCAGGAAGCGCTTCGGTGGGAAGAGACTGCAGATCTACCTTTCTGTCCTCTCCCTCTTCATCAT

GGTGGCCCTTCAAACTTCC - UNI32727 - TCAATCATATTTTCCGGAGCCATATTCATTCAATTGGCCTTGGGATTGAACCTCTACCTGGCTGTCT

TCATCCTATTGGCTATCACTGCTTTTTACACGGTGGCTG - UNI32727 - GGGGTTTGGCCTCAGTGATCTACACAGACTCTGTGCAGACTTTCATC

ATGCTGCTTGGCTCCTTAATTCTCATGGGGTTTG CATTTGCTGAAGTCGGAGGCTACGAGAGCTTTACCGAGAAGTATATGAATGCCATCCCCTCTGTA

GTGGAGGGGGACAACCTGACCATCAGCCCCAAGTGCTACACTCCTCAGCCCGACTCCTTCCACGTCTTCCGAGATCCAGTCACTGGAGACATTCCATGGC

CGGGACTGATATTTGGAATGACCATTTTAGCCATCTGGTACTGGTGTGCCGATCAG GTCATCGTACAGCGCTGCTTATGTGGTAAGAACATGTCCCACG

TGAAGGCCGCCTGCATCCTGTGTGGTTACCTGAAGCTGCTGCCCATGTTCCTCATGGTGATGCCGGGCATGATCAGCCGCATTCTGTACACAG ATAAGG

TGGCCTGCGTTGTACCTTCTGAGTGTGAGAAACAGTGTGGCACTGCGGTCGGCTGCACCAACTATGCCTACCCCACCCTGGTGCTGGAGTTGATGCCTGA

TG GACTGCGAGGCCTGATGCTGTCAGTCATGCTGGCTTCTCTCATGAGCTCTCTGACCTCCATCTTCAACAGCGCCAGCACCCTCTTCACCATCGACCT

GTACACCAAGATAAGGAAGAAGGCATCAGAGAGAGAGCTCATGATAGCCGGACG GATATTTGGCATGGTCCTAATCGCCGTCAGCATCCTGTGGGTCCC

ACTGGTCCAGGTGTCACAGAATGGACAGCTCTTCCACTATATTGGCTCAGTTTCTAGCTACCTTGGGCCTCCCCTTGGTGCAGTCTTCATGCTTGCTATC

TTCTTCAAAAGGGTCAATGAGCAG GGAGCATTCTGGGGGCTAATGGTCGGACTTGTGGTAGGCCTTATTCGCCTGATCGCTGAGTTTGTATACGGAACA

GGCAGCTGCGTGGCTCCCAGTAACTGTCCCAAGATTATCTGTGGAGTGCACTATATGTACTTTGCCATCATACTCTTCTTTGTGTCCATAATAGTAATCC

TGGGAGTCTCCTTCCTAACGGAGCCGATTCCTGATGTTCAC - UNI32919 - CTGTACCGCCTATGCTGGAGTCTTTGGAACAACACAGAGGAGCGG

ATAGACTTGGATGCAGAAGAATTGGAAACTCAAGAAGAAGCTGGTGGTGCTCTTGAAGAAG - UNI32919 - ATTCTGAGCAATCCCGTGGCTGTCT

CAAGAGGGCATGCTGCTTATTGTGTGGTTTGCAGAATACAGGGCCCAAGCTGACCAAAGAAGAGGAGGCAGCTCTGAGGCAGAAGTTCTCAGACACATCT

GAGAAGCCCTTGTGGAGAACCGTCATGAACATCAATGCCGTCCTCCTCCTGGGTGTGGCTGTCTTTGTCCATGCCTATTTTGCCTGAACCCTGAAGGAAG

CAGAAACTATTTGTACTGAGTTTTCTTTTATAAAGTTGGCTGTGTAACAAAGGTAAATGACCGGGAAATGTTTGTGCTTAGATTGCTATACACATGATTT

CTTGCTTTTATCATACCCTTGTGATTAGTTTAAAAATTCTTAAACTCGAGGAGCAGTGGTGGCACATGCCTTTAGTCCCAGCACTTGGGAGGCAGAGGCA

GGCAGATTTCTGAGTTCAAGGCCAGCCTGGTCTACAAAGTGAGTTCCACGACAGCCAGGGCTACACAAAGAAACCCTGTCTCGAAAAACAAAAACAACAA

CAACAAAAAATTCTTAAACTCTATTTAGATATAAACGGCAATGTATATATATATTTTAAGATATACACCATGGTGATTTGATATGTACACACTTTGAAAT

GATTATCATGGTCAATTTAATAGACTCATCATTTGATTTGGTCATCCTCTATGTGTTTATGGTGACAGTATTTGACATGTGCTCACCTAGTAAATTTCAG

TTATACAACAGATTTTTTTTTAAAGTGTGGTCACCATAATTTACATGGGTCCCCAGAATTCTTTTTTTAATCCAAAATTTTATGCCCTTTGATCAACATC

TATTTCAAAACTTGCAATGGATAACTCAGTATTCATTAGCTACGATGTGACATCTCGATGAATGAGGAATTTTAGTCCTCAGAGTGATTCTTACAAGAAG

ATTCAGGATTTGTGTTCAGCTGACGAATTAATCTCTCGGGCAGCCATCGCGCTCCATCTTCTTCTCGTGAAAAAACACAGACCGAGTCCCTTCCCCAGAT

TATAACCAGATCTGAACCCTTCCATTTGTTAGTTAGTGGGTCCTTCCATTTTACCAATGCATAAGAATTAGAGGTAACTGGATGCCAGTGGCGATCCGCT

GCAGACTGACCTTCAATATCAGTTTGCAAAAAATTTAGAACAAATAAAGCAAAGGCAAGATGTGCCTTTGGTGACCTTGGGGGATATAACTGCCCCTGTT

TTGTCTTAAAAAGCCATTTTTTTAAGGTGCGAAGAGCACGTTCAACTATTCCTTGTCCTATGGGGTTATAAGGAATTCAGTTTTATGTTTGTTCAACTAT

TCCTTGTCCTATGGGGTTATAAGGAATTCAGTTTTATGTTTGATACCAAATTTCTTACAGAATGAAATAAAATTTTTACTA
Translation
MASTLSPSITPQTEEPPVVPVRIQNAADISVIVIYFIVVLAVGLW SMVRSNRGTVGGFFLAGHDMAWWP MGASLFASNIGSNHFVGLAGTGAASGIAI

AAVEWN ALLMVLVLGWVFLPIYIKAG - UNI32727 - VLTMPEYLRKRFGGKRLQIYLSVLSLFIMVALQTS - UNI32727 - SIIFSGAIFI

QLALGLNLYLAVFILLAITAFYTVAG - UNI32727 - GGLASVIYTDSVQTFIMLLGSLILMGFA AFAEVGGYESFTEKYMNAIPSVVEGDNLTIS

PKCYTPQPDSFHVFRDPVTGDIPWPGLIFGMTILAIWYWCADQ VIVQRCLCGKNMSHVKAACILCGYLKLLPMFLMVMPGMISRILYTD DKVACVVPS

ECEKQCGTAVGCTNYAYPTLVLELMPDG GLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKIRKKASERELMIAGR RIFGMVLIAVSILWVPLVQ

VSQNGQLFHYIGSVSSYLGPPLGAVFMLAIFFKRVNEQ GAFWGLMVGLVVGLIRLIAEFVYGTGSCVAPSNCPKIICGVHYMYFAIILFFVSIIVILGV

SFLTEPIPDVH - UNI32919 - LYRLCWSLWNNTEERIDLDAEELETQEEAGGALEED - UNI32919 - DSEQSRGCLKRACCLLCGLQNTGPK

LTKEEEAALRQKFSDTSEKPLWRTVMNINAVLLLGVAVFVHAYFA

For any suggestions or comments, please send an email to unitrap@crg.es