Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020227 (Irak3)
Chromosomal location
Chr 10: 119578710 - 119638593 (-)
Description
interleukin-1 receptor-associated kinase 3 Gene [Source:MGI Symbol;Acc:MGI:1921164]
RefSeq_dna
NM_028679 
RefSeq_peptide
NP_082955.2 
UniGene
Mm.146194 
MGI
MGI:1921164 
Uniprot/SWISSPROT
Q8K4B2 
Uniprot/SPTREMBL
Q0VB14 
Human Ortholog
ENSG00000090376 (IRAK3)
Omim 611064 - ASTHMA-RELATED TRAITS, SUSCEPTIBILITY TO, 5  
UniTrap UNI23503
Vector Insertion
Chr 10: 119619765 - 119638382
Public Clones (sanger) IST10031D10 (tigm) IST12777B3 (tigm)
Private Clones OST256009 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36101
Vector Insertion
Chr 10: 119613286 - 119615179
Public Clones IST12252G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30577
Vector Insertion
Chr 10: 119607373 - 119613439
Public Clones IST13028A4 (tigm) IST12141A7 (tigm) IST10984C10 (tigm) IST12985G5BBF1 (tigm)
IST11024H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32911
Vector Insertion
Chr 10: 119603460 - 119607439
Public Clones (sanger) 5SE305D09 (ggtc) IST12343A4 (tigm) IST10877H8 (tigm) IST10466A10 (tigm)
IST10877H9 (tigm) IST12830E3 (tigm) IST10491F12 (tigm) IST11600A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32086
Vector Insertion
Chr 10: 119602148 - 119603576
Public Clones IST10330D1 (tigm) IST14742D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27862
Vector Insertion
Chr 10: 119583686 - 119602148
Public Clones (sanger) E138G04 (ggtc) IST10892H9 (tigm) IST11646A8 (tigm) IST12069D4 (tigm)
IST12841F8 (tigm) IST14762G11 (tigm) IST11794D12 (tigm) IST11733B3 (tigm)
IST10065C1 (tigm) IST10079D7 (tigm)
Private Clones OST45562 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020448
Sequence
GCTGAATTTCCGCGGTTGTGAAAGGCGGTGACAGCGGCGACCTCCCTGCTTCTCTGCGTGGGGTCCCGGGACTCCGCGATGGCCGGCCGGTGCGGGGCCC

GTGGCGCGCTGTCGCCACAGTTGCTGCTCTTCGACCTGCCGCCCGCACTGCTGGGAGAGCTTTGCGGGATCCTGGACAGCTGCGATGGCCCGCTCGGCTG

GCGGGGCCTGG - UNI23503 - CGGAGCGACTTTCAAACAGCTGGCTGGATGTTCGTCATATTGAAAAGTACGTAAACCAAGGTAAAAGTGGAACAA

GAGAATTGCTCTGGTCCTGGGCACAGAAAAACAAGACGATCGGCGACCTTTTAGAGGTTCTCCAGGACATGGGGCATCAACGAGCTATCCACTTAATCAT

CAACTATG GAGTAAGCTGGACTCCTTCAGTGCAGACGCATCACGAGCTTCCATTCCCCAGCTTCCCACCTGAGGTGAAGCATGCGTGCAGAGAAAACGA

CCCTGGACCTCTG GAACCAGCCAATGTCACAGTGGATAATGTTCTTGTTCCTGAACATAATGAAAAAG - UNI30577 - GAACACTGCAGAAAACC

CCTATCAGCTTCCAGAGTATCCTAGAAGGAACCAAACATTTCCACAAAGACTTCCTGATTGGAGAAGGGGAGATATTCGAAGTATACAGAGTGGACATTC

GAAACCAAGCATATGCTGTTAAATTGTTTAAACAG - UNI30577 - - UNI32911 - GAGAAAAAAATGCAACTAAAGAAGCACTGGAAGAGATT

TTTATCAGAACTGGAAGTTCTACTCCT - UNI30577 - - UNI32086 - - UNI32911 - GTTCCGTCACCCCCACATACTAGAGCTGGCTGC

ATATTTCACGGAGACTGAGAAACTTTGTCTGGTTTATCCCTATATGAGCAACGGGACGCTTTTCGACAGATTACAGTGCACA - UNI32086 - - UN

I32911 - AATGGCACAACCCCGCTTTCCTGGCACGTTCGAATCAGCGTATTGATAGGAATAGCCAAAGCCATCCAATACTTGCACAACACTCAGCCGT

GCGCCGTCATCTGTGGCAACGTTTCCAG - UNI27862 - - UNI32086 - TGCAAACATACTCTTGGATGACCAGCTCCAACCCAAACTAACGGA

TTTTGCTGCAGCGCACTTCCGACCCAATCTAGAGCAGCAGAGTTCTACCATAAATATGACCGGCGGTGGCAGGAAACATCTGTGGTACATGCCAGAAGAA

TACATCAGACAGGGAAGACTTTCCGTTAAAACTGATGTCTACAGCTTCGGAATC GTGATCATGGAGGTTCTAACGGGCTGCAAAGTGGTGCTGGATGAC

CCGAAACACGTTCAGCTG CGGGACCTCCTCATGGAACTGATGGAGAAAAGAGGCCTAGACTCCTGCCTGTCCTTCTTAGACAGGAAGATACCACCCTGT

CCTCGGAACTTCTCTGCAAAGCTCTTCTCTCTGGCGGGCCGGTGTGTGGCAACGAAGGCCAAGTTAAGACCCACGATGGACGAA GTCCTGTCCTCTCTG

GAGAGCACCCAGCCTAGCTTGTATTTTGCAGAAGACCCTCCCACGTCCTTGAAGTCCTTCAGGTGTCCTTCTCCACTGTTCTTGGATAATGTCCCAAGTA

TTCCAGTAGAAGATGATGAAAACCAGAATAACCATTCAGTACCTCCCAAGGAAGTTTTGGGGACAGATAGAGTGACTCAGAAAACCCCCTTTGAATGCAG

CCAGTCTGAGGTCACCTTTCTAGGCTTGGACCGAAACAGAGGGAACAGGGGAAGTGAAGCGGATTGCAACGTGCCCAGTTCTTCTCATGAGGAATGCTGG

TCCCCAGAGCTTGTGGCGCCATCCCAGGACTTAAGTCCTACTGTGATCAGTTTGGGCTCGTCTTGGGAAGTACCAGGCCATTCTTATGGGAGCAAGCCAA

TGGAGAAGAGGTGTTCCTCTGGGCTCTTTTGCAGTGAGCATGAACAGTCCAAAAAGCAGTGAATCCACCAGAAGATCAAGCAAAAAATAAAAGCAAACGT

CACTGAAGGCACTGAGCAAATAGCATCCCCGTGAAAAGACACGAGCTCTGAGCTCCGTGAGTACAGCCAAGGGACCAACTGATGGAGAATTTGAATGGTG

CAGATTAGCAGCAAGGAAGTCTATTCCTTCCTCCAAACAGAATAATTTCAAGAGATGCTTTATTCAAGTGACCGCCTCTCAGTCAAACCTGAGAAGCTAA

ACTGGAGCCAATCAGAATTATCCAAGATTCCGGGTTCTGACAACCAAAACCTAGCAAAGAGTAGCAGGACAAGTCTCTCTCTTAAGTCTCTCACTCTCTC

TCATCATCCGAGTGAGATCTTGGTATAGGTGAACAGAGAACCACCCACCTTCCAGAACCAGAACCACCTTTTCCCCAAGCCAGCAGTCAGTCACTCACCA

TCAGCAGCCAGTAGTCACCAGCAGCCAATCATGATACAGTGTCACTCTCCCTCTGCGCATGCCCTACGTCCTTTATAAAACCCAGGTCTTCAGGGCCCAC

CCCTTTCTTTTTCCATCCTTGCTCAGAGGCAGCCTTTTGTATACATTCCCTGACCCCACCCCAATTATATCTCTCATATGATATCTGTTGCGTAGTGTGA

CTTTGTGGCATGACTTGGTTGTCAGATCATTTGCACAAGAACAAACGAATAAACAACAACAAAGCCCACCATCATTACCACCGGCACTTAATGCTAGTCT

TTCTGCTAGGGATACTGACAGTCTATTTGCTTCCCATGGTCATAGGGAAGTTGCTCAAATGCAAAGGTTGTAGGGAATGTCTAATTTGTAAATGGCGTCG

GGTGCCTTTGGAAGGAATTGTGTTTTTACAGCCAGTTGCTACTCTTGTTTATCGCTGGTTAACCGGTCTGTCCGGAAGTGAGCCAAGTCATCCTTGCTAG

GGCTTTTTCTGTGTAGAGAGGGAATTCCAGTCCAAAGTCTGCTTCTCTGTATTTAAATTCTTAGAAGAGTTGCCTGTGGCATTCCAATTGTTATATAAAA

AAATTATATTAAAGAATTACAGC
Translation
MAGRCGARGALSPQLLLFDLPPALLGELCGILDSCDGPLGWRGLA - UNI23503 - AERLSNSWLDVRHIEKYVNQGKSGTRELLWSWAQKNKTIGD

LLEVLQDMGHQRAIHLIINYG GVSWTPSVQTHHELPFPSFPPEVKHACRENDPGPL EPANVTVDNVLVPEHNEKG - UNI30577 - GTLQKTPIS

FQSILEGTKHFHKDFLIGEGEIFEVYRVDIRNQAYAVKLFKQ - UNI30577 - - UNI32911 - EKKMQLKKHWKRFLSELEVLLL - UNI305

77 - - UNI32086 - - UNI32911 - LFRHPHILELAAYFTETEKLCLVYPYMSNGTLFDRLQCT - UNI32086 - - UNI32911 - NGT

TPLSWHVRISVLIGIAKAIQYLHNTQPCAVICGNVSS - UNI27862 - - UNI32086 - SANILLDDQLQPKLTDFAAAHFRPNLEQQSSTINMT

GGGRKHLWYMPEEYIRQGRLSVKTDVYSFGI VIMEVLTGCKVVLDDPKHVQL RDLLMELMEKRGLDSCLSFLDRKIPPCPRNFSAKLFSLAGRCVATK

AKLRPTMDE VLSSLESTQPSLYFAEDPPTSLKSFRCPSPLFLDNVPSIPVEDDENQNNHSVPPKEVLGTDRVTQKTPFECSQSEVTFLGLDRNRGNRGS

EADCNVPSSSHEECWSPELVAPSQDLSPTVISLGSSWEVPGHSYGSKPMEKRCSSGLFCSEHEQSKKQ

For any suggestions or comments, please send an email to unitrap@crg.es