Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020272 (Stk10)
Chromosomal location
Chr 11: 32433266 - 32524593 (+)
Description
serine/threonine kinase 10 Gene [Source:MGI (curated);Acc:Stk10-001]
RefSeq_dna
NM_009288 
RefSeq_peptide
NP_033314.2 
UniGene
Mm.8235 
MGI
MGI:1099439 
Uniprot/SWISSPROT
O55098 
Uniprot/SPTREMBL
A1A553 B1ATW8 Q3UG53 Q5DTS2 
Human Ortholog
ENSG00000072786 (STK10)
Omim not available
UniTrap UNI37220
Vector Insertion
Chr 11: 32487386 - 32488755
Public Clones CMHD-GT_453H2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28873
Vector Insertion
Chr 11: 32489492 - 32496614
Public Clones not available
Private Clones OST17494 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12948
Vector Insertion
Chr 11: 32514714 - 32515780
Public Clones CMHD-GT_352B7-3 (cmhd)
Private Clones OST144316 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31200
Vector Insertion
Chr 11: 32515907 - 32517848
Public Clones IST12155F2 (tigm) IST11935D5 (tigm) IST11271A1 (tigm) IST13928C6 (tigm)
IST12161D4 (tigm) IST13485F2 (tigm) IST10206B4 (tigm) IST12906B10 (tigm)
IST10931E7 (tigm) IST12945B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102821
Sequence
TAGGAGGGGGCGGGGCGGGGCGGGCGGGCCGCGGTTCCTGCAGCTCCCTGTGGCCGCTGGCGCACTCGGCGGGTGCTGCGCTGCGAGGAGGGCGGCTCTC

CGAAGCCGCGGGTCCTGTCGTCGCGCTCCTCATCCAGCATGGCTTTCGCCAATTTCCGCCGCATCTTGCGGTTATCCACCTTCGAGAAGAGAAAGTCCCG

TGAATATGAGCACGTCCGCCGGGACCTGGACCCCAACGATGTATGGGAGATCGTGGGCGAGCTGGGAGACGGCGCCTTCGGCAAAGTCTACAAG GCCAA

AAACAAGGAGACCGGTGCCCTGGCAGCAGCCAAAGTCATAGAGACCAAGAGCGAGGAGGAGCTGGAGGACTACATCGTGGAGATAGAGATCCTGGCCACC

TGTGACCACCCGTATATCGTGAAGCTCCTGGGGGCCTATTACTATGATGGGAAGCTCTGG ATCATGATTGAGTTCTGCCCTGGGGGAGCTGTGGATGCC

ATCATGCTGG AGCTGGATCGAGGCCTCACTGAGCCCCAGATTCAGGTCGTATGCCGCCAGATGTTGGAGGCTCTCAACTTCCTGCACGGCAAGAGGATC

ATCCACCGAGACCTGAAAGCTGGCAACGTGCTTATGACCCTTGAGGGGGACATCAGGCTGG CTGATTTTGGTGTGTCTGCCAAGAATCTGAAAACTCTG

CAAAAGCGAGACTCCTTCATAGGGACACCTTACTG GATGGCCCCTGAGGTGGTGCTGTGTGAAACCATGAAGGACGCCCCCTATGACTACAAGGCTGAC

ATCTGGTCCTTGGGCATCACGCTGATCGAGATGGCGCAGATCGAGCCCCCACACCACGAGCTCAACCCCATGCGGGTCCTGCTCAAGATTGCCAAGTCGG

ACCCTCCTACCCTGCTTACACCCTCCAAGTG GTCTGTGGAGTTCCGAGACTTTCTGAAGATAGCCTTGGATAAGAACCCAGAAACCCGGCCCAGTGCTG

CACAGCTGCTGCAG - UNI28873 - CATCCCTTCGTCAGCAGAGTCACCAGCAATAAGGCTCTTCGGGAGCTGGTGGCCGAGGCAAAGGCGGAGGTA

ATGGAGGAGATTGAGGATGGCAGGGAGGACGGAGAAGAGGAGGATGCTGTGGATGCTGTTCCG CCCCTGGTCAACCACACTCAGGACTCTGCCAATGTA

ACTCAGCCAAGCCTCGACTCCAACAAGCTTCTCCAGGATTCTTCCACCCCCCTGCCTCCCAGCCAGCCTCAGGAGCCTGTGAGCGGGTCCTGTAGCCAAC

CCTCTGGGGATGGACCCCTCCAAACCACCAGCCCTGCAGATGGGCTCTCCAAGAATGACAATGACTTAAAGGTGCCTGTTCCCCTCCGGAAGTCCCGGCC

ACTGTCCATGGATGCCAGAATTCAGATGGATGAAGAGAAACAAATCCCTGACCAGGATGAGAACCCGAGTCCTGCAGCCAGCAAGTCCCAAAAGGCCAAC

CAGAGCCGACCTAACAGCAGTGCCCTGGAGACCTTGGGTGGCGAGGCTCTGACCAACGGTGGCCTGGAACTCCCCAGCTCTGTCACTCCAAGCCATTCTA

AGAGGGCCTCGGACTGTAGCAACCTGTCTACCTCAGAGAGCATGGACTATGGCACCTCCCTGTCTGCTGACCTGTCACTGAACAAAGAAACGGGCTCATT

GTCTCTCAAG GGCTCAAAACTGCACAATAAGACCCTGAAACGGACCCGCCGGTTTGTGGTGGATGGTGTGGAGGTGAGCATCACCACCTCCAAGATCAT

CAGCGAGGATGAGAAGAAAGACGAGGAGATGAGATTTCTCAG GCGCCAGGAGCTCCGAGAGCTTCGGCTTCTGCAGAAAGAAGAACATCGGAACCAGAC

GCAGCTGAGCAGCAAGCACGAGCTGCAGCTGGAGCAGATGCACAAACGTTTTGAACAAGAAATCAAC GCCAAGAAGAAATTCTATGACGTGGAGCTAGA

AAACCTGGAGCGGCAGCAGAAGCAGCAGGTAGAGAAGATGGAGCAGGACCACAGCGTGCGCCGCAAAGAGGAGGCCAAGCGGATCCGCCTGGAGCAGGAT

CGAGACTACGCCAAGTTCCAAGAGCAACTCAAGCAAATGAAGAAGGAG GTGAAGAGTGAGGTTGAGAAACTGCCCCGGCAGCAGCGGAAGGAGAGCATG

AAGCAGAAGATGGAGGAACACTCTCAGAAGAAACAGCGGCTG GACCGGGACTTTGTAGCCAAGCAGAAGGAGGACCTGGAGCTGGCCATGAGGAAGCTC

ACCACGGAAAACAGGCGTGAGATCTGCGACAAGGAACGAGATTGCCTTAGCAAGAAGCAGGAGCTCCTCCGAG ACCGTGAGGCGGCCCTGTGGGAGATG

GAGGAGCACCAGTTGCAGGAGCGACATCAGCTGGTGAAGCAGCAACTGAAGGACCAGTACTTCCTGCAGCGGCATGACCTGCTGCGTAAGCATGAGAAG 

GAGCGGGAACAGATGCAGCGCTACAACCAGCGCATGATGGAGCAGCTGAAGGTCAGACAGCAACAGGAGAAGGCGCGGCTACCCAAGATCCAGAGGAGCG

ACGGCAAGACGCGCATGGCCATGTACAAGAAGAGCCTGCACATCAACGGTGCGGGCAGTGCCTCTGAGCAGCGCGAGAAGATCAAGCAG - UNI12948

 - TTCTCCCAGCAGGAGGAGAAGAGGCAGAAGGCGGAGAGGCTGCAGCAGCAGCAGAAACACGAGAACCAGATGCGAGACATGGTGGCGCAGTGTGAAA

GCAACATGAGCGAGCTACAGCAGCTGCAG - UNI31200 - AATGAAAAGTGTCATCTGTTGGTAGAGCATGAAACCCAGAAGCTGAAGGCCCTGGAT

GAGAGCCACAACCAGAGCCTGAAGGAATGGCGAGACAAGCTTCGGCCACGCAAAAAG GCCCTGGAAGAGGATTTGAACCAGAAGAAGCGGGAACAGGAA

ATGTTCTTCAAATTAAGCGAGGAGGCAGAGCCCAGACCCACCACACCCAGCAAAGCCAGCAACTTCTTCCCCTACAGCTCTGGGGATGCTTCCTAACACC

CACAAGCCTGGGCTGCGGTGGGCAGCGTGGCTACTGGGGCCCCCAAGCCTCTATGAACAAGTGACTCAGGACCTCTTCCTCTTGCTTCTGTGCCAGCTCA

ATTACCCATCCCCCTGCAGCGCCCCAGTTGTCCACAGTGCCACCTTGGTGCACGGTGACCTCCTCAAGACTCAGATTCCCATCACCTAGGAGTGATTTAG

ACTGTTGAGGTCAGGGGCCAGGCAGGATGGGTGAACCCCTCCTGTTTGCCCAAACACCAGCTCTACTGTCTGTGGGCACAAGCGCTACTAATGACATCAC

CGCGAACGCATCCTTATTGTGATCCTTGTGGGTTTTTTGTTTGTTTGTCTGTTTGTTTGTTTGCCTTCAGTAATTCCTCACAGTGTCGGGAAACATCCCT

AAGAGCCACTTGGGTTCTCAGCAGCCAGCTCCCGGGTGTCCCCATTCCCTTGTTTCACATAGCTGACTTTGCTTTGTGTATGTCGGGGTAGGGAGCGTGG

AGAAGGATGCCAGAGATGCCTGTTCTGCTGATTCTGACATTGTATCCCATCTTATTTTCCTCTCCCTGTGAGACATGCAATACACACACACACACACACA

CACACACACACACACACACACACACACACACACACTGCAAATACATAACTTGGCCCCCCTGACACCACCCAGGCTGCCTCTGCTGTGACCTCCTAGGACC

AATGCATTGGAACCTGCTTGCTTGCCTCCTGAGCCTGATCCAGGGCCACTGAGCATGTCAGGTGGAGCAGCTGGTGGGGCCATGCTGAGTGCTGGCGCCA

GAACCCAGAGAAGGCACAGGCTGTACTGCCAGCCTGCAACTCATTTGGCTGCACACAGGATCCCGTGTTCAGGGGTACACCCCCCTCCACACTTGACTTC

TGCTGCCTAGCACGTGCCAATCTCACCCTTGCCCGCTTGTCTGCAGGTACCCAGGAAGGCTTTTGACTTCTGCCCTAGTCCTGTACTGGAGTCCCACTGT

ACATTTCCACTAAGCTTTGGACTTCTCTGTTCAGGAAGAACTGTTCCCCACCCTCAGGAACATGCTGCGCTCAGGGAAATGTGGAGCCTCCATGACTGGG

CCTTCGGGCTGCTCAGGTAGCCTCCCAAGAGGCTGAGCCCCATAGAAGAAAAGCAGCCTAAGTGCTCAGTTACAGTACAGGCAAATGGCTGGCTGCCTCA

GACACCCTCTTTTTAAAAAGCCCCTTCCCAGGGACAATGGGGTGGGGTGGGGGAGGGGGGACCCAGGCGGTTGAGTCTGGCGAGTGGCTGAGACCTTAGC

AGTATTTCTCTGTCACTGCCCGATGCTGAAGCAACTTTCTAAAAAGTTTCCTCAAATGAAAACTGGGTGCTTGGGAGGGAGTGGGCTAGAAAAAAAATAG

GAAAACAGGTCTTGGGACTCCCAGATCTAGTGTGCAGTAAAGAAGCTCACAGAACCCCAGGAAGGCCATAGTTCTCAGGGGAGCGAGTGAGCCTTCGCTT

GCTTTCAGGCCTCACATCAAGGAGTTGACTCAGAGGGCAGATGGGCCAGGCCACGCCACAGGAGGCCGGGCAGGGATACTTGCTTTCAGGGGACTTGACA

GTGGCTATTAGGCAAAATGCTAGTTTTGTGGTTCATATAACAGTCTTTGACCGCTCCCTGACATCATTCGTAATGTTCCAGTCCTTTGTTGAATCTGCAC

TTAGTACCACCTGAGCCCTGGTAGCTCTGCTGTGCCTTTTGGAGTGGGGTCTAGCCTAGTCTTCCAGCCTCATAATTATAGCGTAAGTGCAATGCCTGCC

ACCACCAAGGGCCCACGCAGTATTCCTCATGCCCTGTGCTAATCTTTTCTGTATAGGAACAGGCAGAAGTGTTTTTAGCGCAGTAAATATAACTAACTTA

TATTTCCCTTCATGAAGGATGGAAATAACGTGTATGCATTTCCAAGCACCGTGGATATTTGTAAACTGTTCTCTGCAAACAAAAAAAGAATGTAAATATG

CTTCTAATAAAGTAATAAGGTGATTTGC
Translation
MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNDVWEIVGELGDGAFGKVYK AKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGA

YYYDGKLW IMIEFCPGGAVDAIMLE ELDRGLTEPQIQVVCRQMLEALNFLHGKRIIHRDLKAGNVLMTLEGDIRLA ADFGVSAKNLKTLQKRDSFIG

TPYW WMAPEVVLCETMKDAPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKW WSVEFRDFLKIALDKNPETRPSAAQLLQ

 - UNI28873 - HPFVSRVTSNKALRELVAEAKAEVMEEIEDGREDGEEEDAVDAVP PLVNHTQDSANVTQPSLDSNKLLQDSSTPLPPSQPQEPVS

GSCSQPSGDGPLQTTSPADGLSKNDNDLKVPVPLRKSRPLSMDARIQMDEEKQIPDQDENPSPAASKSQKANQSRPNSSALETLGGEALTNGGLELPSSV

TPSHSKRASDCSNLSTSESMDYGTSLSADLSLNKETGSLSLK GSKLHNKTLKRTRRFVVDGVEVSITTSKIISEDEKKDEEMRFLR RRQELRELRLLQ

KEEHRNQTQLSSKHELQLEQMHKRFEQEIN AKKKFYDVELENLERQQKQQVEKMEQDHSVRRKEEAKRIRLEQDRDYAKFQEQLKQMKKE VKSEVEKL

PRQQRKESMKQKMEEHSQKKQRL DRDFVAKQKEDLELAMRKLTTENRREICDKERDCLSKKQELLRD DREAALWEMEEHQLQERHQLVKQQLKDQYFL

QRHDLLRKHEK EREQMQRYNQRMMEQLKVRQQQEKARLPKIQRSDGKTRMAMYKKSLHINGAGSASEQREKIKQ - UNI12948 - FSQQEEKRQKA

ERLQQQQKHENQMRDMVAQCESNMSELQQLQ - UNI31200 - NEKCHLLVEHETQKLKALDESHNQSLKEWRDKLRPRKK ALEEDLNQKKREQEMF

FKLSEEAEPRPTTPSKASNFFPYSSGDAS

For any suggestions or comments, please send an email to unitrap@crg.es