Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020280 (Pus10)
Chromosomal location
Chr 11: 23565674 - 23632876 (+)
Description
pseudouridylate synthase 10 Gene [Source:MGI (curated);Acc:Pus10-004]
RefSeq_dna
NM_001033654 NM_028304 NM_028956 
RefSeq_peptide
NP_001028826.1 NP_082580.1 NP_083232.1 
UniGene
Mm.29536 
MGI
MGI:1921717 
Uniprot/SWISSPROT
Q9D3U0 
Uniprot/SPTREMBL
B0QZU5 
Human Ortholog
ENSG00000162927 (PUS10)
Omim not available
UniTrap UNI35503
Vector Insertion
Chr 11: 23565749 - 23565975
Public Clones IST14678G7 (tigm) IST12270C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30160
Vector Insertion
Chr 11: 23566454 - 23567287
Public Clones D097G02 (ggtc) IST15007H3 (tigm) IST12581B10 (tigm) IST14393E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7447
Vector Insertion
Chr 11: 23573325 - 23599929
Public Clones RRS858 (baygenomics) IST14752A8 (tigm)
Private Clones OST231389 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24108
Vector Insertion
Chr 11: 23599965 - 23602889
Public Clones not available
Private Clones OST234343 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23547
Vector Insertion
Chr 11: 23603002 - 23606884
Public Clones not available
Private Clones OST253756 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20069
Vector Insertion
Chr 11: 23620222 - 23625431
Public Clones not available
Private Clones OST373951 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109525
Sequence
AACGGCTTCAACCGCCTCCTGCCAAGTCCCCGCTCTGGCCTCCAAAGTCGCGGCCCAAACACCTCACACTCACTG - UNI30160 - TATGCTTCCAC

TGACTGAGGAGAACAAGCACGTGGCACAGCTGTTGTTCAGTTCTGGCACCTGTCCAAGATGCATCTTAAGATTCTGTGGTGTGGATCTTCCCGCACCTTA

CAAACACCCATCCAAG GAGTTGCTCAATGAGCTACAAAAATTTCTAGAACCGGAAAAACCTGAATTAATTTTAGAAGCTCCAAACCCACCATTGAAGAA

AATTCGTCTACATGAAGATGGGATTGATAATTTGAGTGAAGATGGAAAGGAGGGAGTCTCTGTTACTGAAGATGAAAGCATGGCTGAGAAGCCTTCAAAG

CTGAGAGTGTGCAATGTTTGCTTAGGAATTCTTCAGGAATTCTGTGAGAAGGGGTTTATTACGAAG GTGTGCCAAAAGGTTGAAGCCTCTGGGTTTGAA

TTCACCAGCGTGGTTTTATCTGTCTCCTTTCCACCGCAGCTGTCTGTAAGAGAG - UNI7447 - CATGCTGCATGGTTGCTGGTAAAACAGGAAATG

GG - UNI24108 - AAAGCAGAGTCTGTCCCTGGGAAGAAATGATGTAGTCCAGCTGAAAGAAGCCTACAAGTGGATAACTCACCCCCTGTTTTCAGA

GGAGCTGGGCGTTCCCACTGATGGAAAG - UNI23547 - AGCTTGTTCGAAGTGAGCGTGGTCTTTGCTCATCCAGAAACAGCTGAAGATTGCCATT

TCCT AGGTGAAGTTTGCCGAGATTGTTTCAAACCAGCTAAAAATAAACAG TCGGTATTTACCAGAATGGCAGTTTTGAAAGCTTTGAGTAAGATAAAA

GAAGAAGACTTCCTCGG GCAATTTCCTTGTCCTCCAAACTCACCGAAGACTGTATGCACTGTCCTTGAAGTTGAGTGCACTCATGGTGCTGTTTTTGTC

GCTG GCAGATATAATAAATACTCCAGGAATCTACCACAAACTCCTTGGATAATTGATGGAGAAAGGAAAATGGAATCTTCGGTGGAAGAATTAATTTCA

GATCATCTTCTGGCAGTATTCAGAGCAGAGA GTTTTAATTTCTCATCCTCGGGACGAGAAGACGTAGACGTGAGAACATTAGGAAATG GAAGGCCCTT

TGCAGTTGAACTTCTGAATCCTCATCGAGTGCATTTCACCTCACAAGAAATGAAGGAGCTCCAGCAG ACAATTAATAAATCATCTGACAAAATCCAAGT

CCGTGACTTGCAGCTTGTCACCAG GGAGGCAATAGGGCATATGAAGGAAGGTGAGGAAGAAAAGACTAAGACCTACAGTGCCTTGATATGGACGAATAG

AGCTATCCAGAAGAAGGACATTGGGTTCCTGGACGACTTAAAG - UNI20069 - GACTTAAAGATTGACCAGAAAACACCTCTCCGAGTCCTTCACC

GAAGGCCTTTGGCTGTGAGAACTCGGGCCATTCACTCTATGAAGACACACTACCTGGATGAGCATCATTTTCGTCTGCATTTGAAGACCCAAGCTGGAAC

 CTACATTAAAGAATTTGTACATGGAGACTTTGGGAGAACCAAACCAAACCTTGGCTCTTTGATGAACGTGACTGCAGACATTCTTGAGCTGGATGTGGA

G TCTGTAGATGTTGACTGGCCGCCTGCTCTGGATGACTAGCTCCCACGTGTGAACACAAAAGGCTTTCCTGGCATGATGTGGACATACAGGCAGCATAT

CCTGGAAAATGACTGTTTACCCACCATAACGGTGTCTTCAAAACCACTTGGATCATGTTGATCTGTTCCTAAAGTTCACTGTAACATCTCAGGATCTATT

TGTACGCATATTTTGTGTTGTGTTGTGTTGTTCTAAGAATGTCTTATGTTTTCTCATTCCCTGTCTCATGACCACAAAACCAAAATAGAAGGAATGAAAC

CATTTTCCTTCTAAAGTCTGTTACTTAGAGAGAGATGTAATGGGAGGCCCTGTCAGTCAGGAGAGCTGGGACTTCTAGCATAATCTCCTGCAGGGGATGA

TACCTTCAAAGTAACTTGCTAAAGCTTTCAGATCATCTGAATAAATGTTACAACTAGACTCATGTAGAAGAGTGTCCTATAATATTCCAATATGTCAAAT

GTAAATCTGATTCTAATATTTTCCAGTTACTCTCAAACAAGCTTCTATTATCAATAGAAGTACTTTAAGGAACAATTTGTCATAGTCCTTATGACCTCAA

GTGACTATTTTGACAATCGAAAATTGTCAGTATGTGTCTCCTGCAAAGCAAGTGACACCTTACCCCTGGAGGCGTACTCTAGACACTGCCTACCTCTTTT

GTCTTTTATGTAAAGAGAAACAAGTGCCTTCAGTAACTTTTGTCCCAGAGTTACAAATTTGAAAATTCGATAATGCTAAACAAATACAAACATATTTTGG

TGTTTCAATTATTTTCCAATTTCAAATGTTTTCTAATTTCAAGTGGTCTATCTAACATCTGATTACATAAACAAGGAAACAAAAGTTAAATGACACACCT

AGTTACTCTTATAACAGGTCTGGAGCTGATGTTGTGTCTCCAGGAGCCTTTCTAAAAACCCTTGTCAGGAGCACCTGCATCTCCTGTGGGTGACAGTGTC

CTAAGAAGGACAGTTAGGCTTACAAAGCCAGGAGGTTGGCTTCTGGAACTTGGATATCAAGTGACGCCCCCAAGAAATGGCTAATGGTATGTCTTATATG

ATCTCATAATTGTCAATTGTAATGGCATGGTGAAGAGAAATCTTAAACATATTGAACCAGAAGAATTAATCATCAAAAATACCAGAAGGGAAGCTCAATA

AAATTTTGACTTAAGTAAAATTTTCATCAGCTAGTGCAACTTCTTGACTTTTTTTGATGCATTGATTTGAATAGCATTTGATTATTCACGTTTCTCATCT

TTGCACACAATTCATACTGACTCTGAAAGATGTATTATATCAGGAAGATGTTTTTGATTGCGATGAAAGGGCAGCCTGCTCCTTTGAAACCTTGTTTCAT

CATGTGTGAATAATAGCAAAGGGTTTTTCATTGTCAGAAAATTGAAAAGGAGATAACAGAAACTAACTGATGAAAAGTGAAAAGTTAAAGACTTCTATGT

AATGTTTCTCAGCTTCTGATGAAATTTTGCTAAAAGATTAAATAATTTGGGAAAAGTC
Translation
 - UNI30160 - MLPLTEENKHVAQLLFSSGTCPRCILRFCGVDLPAPYKHPSK ELLNELQKFLEPEKPELILEAPNPPLKKIRLHEDGIDNLSEDG

KEGVSVTEDESMAEKPSKLRVCNVCLGILQEFCEKGFITK VCQKVEASGFEFTSVVLSVSFPPQLSVRE - UNI7447 - HAAWLLVKQEMG - UN

I24108 - GKQSLSLGRNDVVQLKEAYKWITHPLFSEELGVPTDGK - UNI23547 - SLFEVSVVFAHPETAEDCHFL LGEVCRDCFKPAKNKQ 

SVFTRMAVLKALSKIKEEDFLG GQFPCPPNSPKTVCTVLEVECTHGAVFVAG GRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAES SF

NFSSSGREDVDVRTLGNG GRPFAVELLNPHRVHFTSQEMKELQQ TINKSSDKIQVRDLQLVTR REAIGHMKEGEEEKTKTYSALIWTNRAIQKKDIG

FLDDLK - UNI20069 - DLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDEHHFRLHLKTQAGT TYIKEFVHGDFGRTKPNLGSLMNVTADILEL

DVE SVDVDWPPALDD
Transcript ENSMUST00000058163
Sequence
GTGTGGTCAGGCGAAGCTGGAGGAAGGAGGAAGGGAACAGCTAATTTGCTGGGGTGTGGGAGGGGGTCGGGAGTCGGGAGAGCGGGACGTCCCTCTTTCT

TTTCCCTAGTCTGGGTTTCAAATTTGAGTAGGGGCTCATCGACGTTTCTGGCAGCAGCTACTACGACCTAGGTGCCGAGTCCGTCGGAGGCTCCTTTGCC

GGCCGACCCTTTAAGGCTAGCAGTAAAGCCCCTCGCAGTCTTTCGTTCGTAGAGCTAGGGGGAGTGCAGGCTGCCAGGCGGACAGCCTTACAGGTCACCG

TGTAAGACGAGGGGGTTCCTGCATTCCTCTCGTGAGGGGCCTGGTACTTTCGTTGTAAAGCTCTGGTTTTCTTGGGGAACACAACGGCTGAGCGCAGTAG

GTGCGCTGTCTTTACTCTTCCCCGTTCCCACCCAGGGCCGAAAAGGGTTAAGACTCGGCTGCGGCATCTTGGGAGAAG - UNI30160 - TTTCTTCT

AGTATGCTTCCACTGACTGAGGAGAACAAGCACGTGGCACAGCTGTTGTTCAGTTCTGGCACCTGTCCAAGATGCATCTTAAGATTCTGTGGTGTGGATC

TTCCCGCACCTTACAAACACCCATCCAAG GAGTTGCTCAATGAGCTACAAAAATTTCTAGAACCGGAAAAACCTGAATTAATTTTAGAAGCTCCAAACC

CACCATTGAAGAAAATTCGTCTACATGAAGATGGGATTGATAATTTGAGTGAAGATGGAAAGGAGGGAGTCTCTGTTACTGAAGATGAAAGCATGGCTGA

GAAGCCTTCAAAGCTGAGAGTGTGCAATGTTTGCTTAGGAATTCTTCAGGAATTCTGTGAGAAGGGGTTTATTACGAAG GTGTGCCAAAAGGTTGAAGC

CTCTGGGTTTGAATTCACCAGCGTGGTTTTATCTGTCTCCTTTCCACCGCAGCTGTCTGTAAGAGAG - UNI7447 - CATGCTGCATGGTTGCTGGT

AAAACAGGAAATGGG - UNI24108 - AAAGCAGAGTCTGTCCCTGGGAAGAAATGATGTAGTCCAGCTGAAAGAAGCCTACAAGTGGATAACTCACC

CCCTGTTTTCAGAGGAGCTGGGCGTTCCCACTGATGGAAAG - UNI23547 - AGCTTGTTCGAAGTGAGCGTGGTCTTTGCTCATCCAGAAACAGCT

GAAGATTGCCATTTCCT AGGTGAAGTTTGCCGAGATTGTTTCAAACCAGCTAAAAATAAACAG TCGGTATTTACCAGAATGGCAGTTTTGAAAGCTTT

GAGTAAGATAAAAGAAGAAGACTTCCTCGG GCAATTTCCTTGTCCTCCAAACTCACCGAAGACTGTATGCACTGTCCTTGAAGTTGAGTGCACTCATGG

TGCTGTTTTTGTCGCTG GCAGATATAATAAATACTCCAGGAATCTACCACAAACTCCTTGGATAATTGATGGAGAAAGGAAAATGGAATCTTCGGTGGA

AGAATTAATTTCAGATCATCTTCTGGCAGTATTCAGAGCAGAGA GTTTTAATTTCTCATCCTCGGGACGAGAAGACGTAGACGTGAGAACATTAGGAAA

TG GAAGGCCCTTTGCAGTTGAACTTCTGAATCCTCATCGAGTGCATTTCACCTCACAAGAAATGAAGGAGCTCCAGCAG ACAATTAATAAATCATCTG

ACAAAATCCAAGTCCGTGACTTGCAGCTTGTCACCAG GGAGGCAATAGGGCATATGAAGGAAGGTGAGGAAGAAAAGACTAAGACCTACAGTGCCTTGA

TATGGACGAATAGAGCTATCCAGAAGAAGGACATTGGGTTCCTGGACGACTTAAAG - UNI20069 - GACTTAAAGATTGACCAGAAAACACCTCTC

CGAGTCCTTCACCGAAGGCCTTTGGCTGTGAGAACTCGGGCCATTCACTCTATGAAGACACACTACCTGGATGAGCATCATTTTCGTCTGCATTTGAAGA

CCCAAGCTGGAAC CTACATTAAAGAATTTGTACATGGAGACTTTGGGAGAACCAAACCAAACCTTGGCTCTTTGATGAACGTGACTGCAGACATTCTTG

AGCTGGATGTGGAG TCTGTAGATGTTGACTGGCCGCCTGCTCTGGATGACTAGCTCCCACGTGTGAACACAAAAGGCTTTCCTGGCATGATGTGGACAT

ACAGGCAGCATATCCTGGAAAATGACTGTTTACCCACCATAACGGTGTCTTCAAAACCACTTGGATCATGTTGATCTGTTCCTAAAGTTCACTGTAACAT

CTCAGGATCTATTTGTACGCATATTTTGTGTTGTGTTGTGTTGTTCTAAGAATGTCTTATGTTTTCTCATTCCCTGTCTCATGACCACAAAACCAAAATA

GAAGGAATGAAACCATTTTCCTTCTAAAGTCTGTTACTTAGAGAGAGATGTAATGGGAGGCCCTGTCAGTCAGGAGAGCTGGGACTTCTAGCATAATCTC

CTGCAGGGGATGATACCTTCAAAGTAACTTGCTAAAGCTTTCAGATCATCTGAATAAATGTTACAACTAGACTCATGTAGAAGAGTGTCCTATAATATTC

CAATATGTCAAATGTAAATCTGATTCTAATATTTTCCAGTTACTCTCAAACAAGCTTCTATTATCAATAGAAGTACTTTAAGGAACAATTTGTCATAGTC

CTTATGACCTCAAGTGACTATTTTGACAATCGAAAATTGTCAGTATGTGTCTCCTGCAAAGCAAGTGACACCTTACCCCTGGAGGCGTACTCTAGACACT

GCCTACCTCTTTTGTCTTTTATGTAAAGAGAAACAAGTGCCTTCAGTAACTTTTGTCCCAGAGTTACAAATTTGAAAATTCGATAATGCTAAACAAATAC

AAACATATTTTGGTGTTTCAATTATTTTCCAATTTCAAATGTTTTCTAATTTCAAGTGGTCTATCTAACATCTGATTACATAAACAAGGAAACAAAAGTT

AAATGACACACCTAGTTACTCTTATAACAGGTCTGGAGCTGATGTTGTGTCTCCAGGAGCCTTTCTAAAAACCCTTGTCAGGAGCACCTGCATCTCCTGT

GGGTGACAGTGTCCTAAGAAGGACAGTTAGGCTTACAAAGCCAGGAGGTTGGCTTCTGGAACTTGGATATCAAGTGACGCCCCCAAGAAATGGCTAATGG

TATGTCTTATATGATCTCATAATTGTCAATTGTAATGGCATGGTGAAGAGAAATCTTAAACATATTGAACCAGAAGAATTAATCATCAAAAATACCAGAA

GGGAAGCTCAATAAAATTTTGACTTAAGTAAAATTTTCATCAGCTAGTGCAACTTCTTGACTTTTTTTGATGCATTGATTTGAATAGCATTTGATTATTC

ACGTTTCTCATCTTTGCACACAATTCATACTGACTCTGAAAGATGTATTATATCAGGAAGATGTTTTTGATTGCGATGAAAGGGCAGCCTGCTCCTTTGA

AACCTTGTTTCATCATGTGTGAATAATAGCAAAGGGTTTTTCATTGTCAGAAAATTGAAAAGGAGATAACAGAAACTAACTGATGAAAAGTGAAAAGTTA

AAGACTTCTATGTAATGTTTCTCAGCTTCTGATGAAATTTTGCTAAAAGATTAAATAATTTGGGAAAAGTC
Translation
 - UNI30160 - MLPLTEENKHVAQLLFSSGTCPRCILRFCGVDLPAPYKHPSK ELLNELQKFLEPEKPELILEAPNPPLKKIRLHEDGIDNLSEDG

KEGVSVTEDESMAEKPSKLRVCNVCLGILQEFCEKGFITK VCQKVEASGFEFTSVVLSVSFPPQLSVRE - UNI7447 - HAAWLLVKQEMG - UN

I24108 - GKQSLSLGRNDVVQLKEAYKWITHPLFSEELGVPTDGK - UNI23547 - SLFEVSVVFAHPETAEDCHFL LGEVCRDCFKPAKNKQ 

SVFTRMAVLKALSKIKEEDFLG GQFPCPPNSPKTVCTVLEVECTHGAVFVAG GRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAES SF

NFSSSGREDVDVRTLGNG GRPFAVELLNPHRVHFTSQEMKELQQ TINKSSDKIQVRDLQLVTR REAIGHMKEGEEEKTKTYSALIWTNRAIQKKDIG

FLDDLK - UNI20069 - DLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDEHHFRLHLKTQAGT TYIKEFVHGDFGRTKPNLGSLMNVTADILEL

DVE SVDVDWPPALDD
Transcript ENSMUST00000020520
Sequence
AACGGCTTCAACCGCCTCCTGCCAAGTCCCCGCTCTGGCCTCCAAAGTCGCGGCCCAAACACCTCACACTCACTG - UNI30160 - TTTCTTCTAGT

ATGCTTCCACTGACTGAGGAGAACAAGCACGTGGCACAGCTGTTGTTCAGTTCTGGCACCTGTCCAAGATGCATCTTAAGATTCTGTGGTGTGGATCTTC

CCGCACCTTACAAACACCCATCCAAG GAGTTGCTCAATGAGCTACAAAAATTTCTAGAACCGGAAAAACCTGAATTAATTTTAGAAGCTCCAAACCCAC

CATTGAAGAAAATTCGTCTACATGAAGATGGGATTGATAATTTGAGTGAAGATGGAAAGGAGGGAGTCTCTGTTACTGAAGATGAAAGCATGGCTGAGAA

GCCTTCAAAGCTGAGAGTGTGCAATGTTTGCTTAGGAATTCTTCAGGAATTCTGTGAGAAGGGGTTTATTACGAAG GTGTGCCAAAAGGTTGAAGCCTC

TGGGTTTGAATTCACCAGCGTGGTTTTATCTGTCTCCTTTCCACCGCAGCTGTCTGTAAGAGAG - UNI7447 - CATGCTGCATGGTTGCTGGTAAA

ACAGGAAATGGG - UNI24108 - AAAGCAGAGTCTGTCCCTGGGAAGAAATGATGTAGTCCAGCTGAAAGAAGCCTACAAGTGGATAACTCACCCCC

TGTTTTCAGAGGAGCTGGGCGTTCCCACTGATGGAAAG - UNI23547 - AGCTTGTTCGAAGTGAGCGTGGTCTTTGCTCATCCAGAAACAGCTGAA

GATTGCCATTTCCT AGGTGAAGTTTGCCGAGATTGTTTCAAACCAGCTAAAAATAAACAG TCGGTATTTACCAGAATGGCAGTTTTGAAAGCTTTGAG

TAAGATAAAAGAAGAAGACTTCCTCGG GCAATTTCCTTGTCCTCCAAACTCACCGAAGACTGTATGCACTGTCCTTGAAGTTGAGTGCACTCATGGTGC

TGTTTTTGTCGCTG GCAGATATAATAAATACTCCAGGAATCTACCACAAACTCCTTGGATAATTGATGGAGAAAGGAAAATGGAATCTTCGGTGGAAGA

ATTAATTTCAGATCATCTTCTGGCAGTATTCAGAGCAGAGA GTTTTAATTTCTCATCCTCGGGACGAGAAGACGTAGACGTGAGAACATTAGGAAATG 

GAAGGCCCTTTGCAGTTGAACTTCTGAATCCTCATCGAGTGCATTTCACCTCACAAGAAATGAAGGAGCTCCAGCAG ACAATTAATAAATCATCTGACA

AAATCCAAGTCCGTGACTTGCAGCTTGTCACCAG GGAGGCAATAGGGCATATGAAGGAAGGTGAGGAAGAAAAGACTAAGACCTACAGTGCCTTGATAT

GGACGAATAGAGCTATCCAGAAGAAGGACATTGGGTTCCTGGACGACTTAAAG - UNI20069 - GACTTAAAGATTGACCAGAAAACACCTCTCCGA

GTCCTTCACCGAAGGCCTTTGGCTGTGAGAACTCGGGCCATTCACTCTATGAAGACACACTACCTGGATGAGCATCATTTTCGTCTGCATTTGAAGACCC

AAGCTGGAAC CTACATTAAAGAATTTGTACATGGAGACTTTGGGAGAACCAAACCAAACCTTGGCTCTTTGATGAACGTGACTGCAGACATTCTTGAGC

TGGATGTGGAG TCTGTAGATGTTGACTGGCCGCCTGCTCTGGATGACTAGCTCCCACGTGTGAACACAAAAGGCTTTCCTGGCATGATGTGGACATACA

GGCAGCATATCCTGGAAAATGACTGTTTACCCACCATAACGGTGTCTTCAAAACCACTTGGATCATGTTGATCTGTTCCTAAAGTTCACTGTAACATCTC

AGGATCTATTTGTACGCATATTTTGTGTTGTGTTGTGTTGTTCTAAGAATGTCTTATGTTTTCTCATTCCCTGTCTCATGACCACAAAACCAAAATAGAA

GGAATGAAACCATTTTCCTTCTAAAGTCTGTTACTTAGAGAGAGATGTAATGGGAGGCCCTGTCAGTCAGGAGAGCTGGGACTTCTAGCATAATCTCCTG

CAGGGGATGATACCTTCAAAGTAACTTGCTAAAGCTTTCAGATCATCTGAATAAATGTTACAACTAGACTCATGTAGAAGAGTGTCCTATAATATTCCAA

TATGTCAAATGTAAATCTGATTCTAATATTTTCCAGTTACTCTCAAACAAGCTTCTATTATCAATAGAAGTACTTTAAGGAACAATTTGTCATAGTCCTT

ATGACCTCAAGTGACTATTTTGACAATCGAAAATTGTCAGTATGTGTCTCCTGCAAAGCAAGTGACACCTTACCCCTGGAGGCGTACTCTAGACACTGCC

TACCTCTTTTGTCTTTTATGTAAAGAGAAACAAGTGCCTTCAGTAACTTTTGTCCCAGAGTTACAAATTTGAAAATTCGATAATGCTAAACAAATACAAA

CATATTTTGGTGTTTCAATTATTTTCCAATTTCAAATGTTTTCTAATTTCAAGTGGTCTATCTAACATCTGATTACATAAACAAGGAAACAAAAGTTAAA

TGACACACCTAGTTACTCTTATAACAGGTCTGGAGCTGATGTTGTGTCTCCAGGAGCCTTTCTAAAAACCCTTGTCAGGAGCACCTGCATCTCCTGTGGG

TGACAGTGTCCTAAGAAGGACAGTTAGGCTTACAAAGCCAGGAGGTTGGCTTCTGGAACTTGGATATCAAGTGACGCCCCCAAGAAATGGCTAATGGTAT

GTCTTATATGATCTCATAATTGTCAATTGTAATGGCATGGTGAAGAGAAATCTTAAACATATTGAACCAGAAGAATTAATCATCAAAAATACCAGAAGGG

AAGCTCAATAAAATTTTGACTTAAGTAAAATTTTCATCAGCTAGTGCAACTTCTTGACTTTTTTTGATGCATTGATTTGAATAGCATTTGATTATTCACG

TTTCTCATCTTTGCACACAATTCATACTGACTCTGAAAGATGTATTATATCAGGAAGATGTTTTTGATTGCGATGAAAGGGCAGCCTGCTCCTTTGAAAC

CTTGTTTCATCATGTGTGAATAATAGCAAAGGGTTTTTCATTGTCAGAAAATTGAAAAGGAGATAACAGAAACTAACTGATGAAAAGTGAAAAGTTAAAG

ACTTCTATGTAATGTTTCTCAGCTTCTGATGAAATTTTGCTAAAAGATTAAATAATTTGGGAAAAGTC
Translation
 - UNI30160 - MLPLTEENKHVAQLLFSSGTCPRCILRFCGVDLPAPYKHPSK ELLNELQKFLEPEKPELILEAPNPPLKKIRLHEDGIDNLSEDG

KEGVSVTEDESMAEKPSKLRVCNVCLGILQEFCEKGFITK VCQKVEASGFEFTSVVLSVSFPPQLSVRE - UNI7447 - HAAWLLVKQEMG - UN

I24108 - GKQSLSLGRNDVVQLKEAYKWITHPLFSEELGVPTDGK - UNI23547 - SLFEVSVVFAHPETAEDCHFL LGEVCRDCFKPAKNKQ 

SVFTRMAVLKALSKIKEEDFLG GQFPCPPNSPKTVCTVLEVECTHGAVFVAG GRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAES SF

NFSSSGREDVDVRTLGNG GRPFAVELLNPHRVHFTSQEMKELQQ TINKSSDKIQVRDLQLVTR REAIGHMKEGEEEKTKTYSALIWTNRAIQKKDIG

FLDDLK - UNI20069 - DLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDEHHFRLHLKTQAGT TYIKEFVHGDFGRTKPNLGSLMNVTADILEL

DVE SVDVDWPPALDD

For any suggestions or comments, please send an email to unitrap@crg.es