Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020282 (Rhbdf1)
Chromosomal location
Chr 11: 32109587 - 32122280 (-)
Description
rhomboid family 1 (Drosophila) Gene [Source:MGI (curated);Acc:Rhbdf1-006]
RefSeq_dna
NM_010117 
RefSeq_peptide
NP_034247.1 
MGI
MGI:104328 
Uniprot/SWISSPROT
Q6PIX5 
Uniprot/SPTREMBL
A2AVE4 A2AVE5 Q04843 
Human Ortholog
ENSG00000007384 (RHBDF1)
Omim not available
UniTrap UNI27213
Vector Insertion
Chr 11: 32116283 - 32122168
Public Clones IST15058D6 (tigm)
Private Clones OST66713 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102828
Sequence
GGACGGGTCGGGCCGGCGCGCGGGCGGCGCAGGCAGGGACTAGGCGCGGGCGCCCTCCCGGCCCGCAGCGGCGGCAGCAGCCGGTGCAGACCCTTCTGAG

GACCCTACGGCG - UNI27213 - GCTTGTCTCACTGCGCCCGGAACCATGAGTGAAGCCAGGAGAGACAGTACTAGCAGCCTGCAACGCAAGAAACC

CCCATGGCTCAAGTTGGACATCCCAGCCGCGGTGCCCCCGGCAGCAGAGGAGCCCAGCTTCCTGCAG CCCCTGCGGCGACAGGCTTTCTTGCGGAGTGT

GAGTATGCCAGCTGAGACAGCCCGGGTCCCATCACCCCACCATGAGCCTCGCCGGCTGGTGCTGCAGCGTCAGACATCCATCACACAGACCATCCGCAG 

CCGGCAGGTACGCTTTGGGCGTGTTCATACTCTGCCCCTTTTGAGGCCGAGGGCTGCTCGAAAGGCCCACCCACAGCGCCAGTCTCTCTCATGGTCCTTG

CTCAG GGGGACAGCAGACTGGTTTGGAGTGAGCAAGGACAGTGACAGCACCCAGAAGTGGCAGCGCAAGAGCATCCGTCACTGCAGCCAGCGGTATGGG

AAGCTAAAGCCGCAGGTCATCCGGGAGCTGGACCTGCCCAGCCAGGACAATGTGTCCCTAACCAGCACCGAGACACCACCTCCCCTCTACGTGGGGCCAT

GCCAGCTGGGCATGCAGAAG CTCCCGCTCAGGTTTCAACCGACTCCCTCGGCGTCGCAAACGTGAATCGGTGGCCAAGATGAGCTTCCGGGCCGCTGCA

GCATTGGTGAAG GGTCGGTCTATTAGGGATGGCACTTTACGAAGGGGACAGCGCCGAAGCTTTACCCCTGCCAGCTTTCTTGAGGAAGACATGGTGGAC

TTCCCTGATGAGTTGGATACATCTTTCTTTGCTCGG GAAGGTGTCCTCCACGAGGAGATGTCCACGTACCCAGATGAGGTGTTTGAGTCCCCATCAGAG

GCAGCGCTCAAGGACTGGGAGAAAGCCCCGGATCAGGCCGACCTCACGGGTGGGGCCCTGGACCGCAGTGAGCTTGAGAGAAGCCACTTGATGTT GCCC

CTGGAACGAGGCTGGAGAAAGCAGAAGGAAGGCGGCCCTCTAGCCCCGCAGCCCAAGGTGCGGCTTCGCCAGGAGGTGGTCAGTGCGGCGGGACCCAGGA

GGGGTCAGCGTATCGCTGTGCCAGTGCGCAAACTCTTCGCTCGGGAAAAGCGGCCTTATGGTCTGGGGATGGTGGGACGGCTCACCAACCGCACGTACCG

GAAACGCATCGACAGCTATGTCAAGCGGCAGATCGAGGACATGGATGATCACAG GCCCTTCTTCACTTACTGGCTCACCTTTGTGCACTCACTGGTCAC

CATTCTGGCTGTGTGCATCTATGGCATAGCGCCCGTGGGCTTCTCGCAGCATGAGACGGTGGACTCG GTACTTCGGAAGCGGGGTGTCTATGAGAATGT

CAAATACGTCCAGCAGGAGAACTTCTGGATTGGCCCCAGCTCG GAGGCCCTCATTCACTTGGGTGCCAAGTTCTCACCCTGCATGCGTCAGGACCCACA

GGTGCACAGCTTCATCCTGGCTGCCCGGGAGCGTGAAAAGCACTCGGCTTGCTGTGTACGCAATGATCGGTCTGGGTGTGTGCAGACTTCCAAGGAGGAG

TGCTCG TCCACGTTGGCGGTGTGGGTGAAGTGGCCCGTTCATCCTAGTGCCCCAGACCTTGCAGGCAACAAGAGACAGTTTGGTTCTGTCTGCCACCAG

GACCCCAG GGTATGTGACGAGCCTTCCTCTGAGGATCCCCACGAGTGGCCAGAAGATATCACCAAGTGGCCG ATCTGCACCAAAAGCAGCGCGGGGAA

CCACACTAACCACCCTCACATGGATTGTGTCATAACAGGCCGGCCTTGCTGCATCGGCACCAAGGGCAG GTGTGAGATCACCTCCCGGGAGTACTGTGA

CTTCATGAGGGGCTACTTCCATGAGGAGGCCACACTCTGCTCTCAG GTGCACTGCATGGACGATGTCTGTGGCCTCCTGCCTTTCCTCAATCCTGAGGT

GCCTGACCAGTTCTACCGCCTGTGGCTGTCCCTCTTCCTGCACGCTGG GATCCTGCACTGCTTGGTGTCCGTCTGCTTCCAGATGACGGTCCTGCGGGA

CCTGGAGAAGCTGGCAGGCTGGCACCGCATAGCCATCATCTACCTGCTGAGTGGTATCACGGGCAATCTAGCCAGTGCCATCTTCCTGCCATACCGGGCA

GAG GTAGGTCCGGCCGGCTCCCAGTTTGGCATCCTGGCCTGCCTCTTTGTGGAGTTGTTCCAGAGCTGGCAGATCCTGGCCCGACCCTGGCGTGCCTTC

TTCAAGCTCCTGGCCGTGGTGCTCTTCCTCTTTGCCTTTGGGCTGCTGCCCTGGATCGACAACTTCGCCCACATCTCGGGCTTTGTCAGCGGCCTCTTCC

TTTCCTTTGCCTTCCTGCCTTACATCAGCTTTGGCAAGTTCGACCTGTACCGCAAGCGCTGCCAGATCATCATCTTCCAGGTCGTCTTCCTGGGCCTGCT

GGCCGGCCTGGTGGTCCTCTTCTACTTCTACCCGGTGCGCTGTGAATGGTGCGAGTTCCTCACCTGCATCCCTTTCACGGACAAGTTCTGTGAAAAGTAC

GAGCTGGACGCTCAGCTCCACTGAACCAGCCGTGGACTCCCCAGGCCAGCCCGGCCTCCCAGGGCTGAACAGATGGGTGCTTCCTGGACACTGACCTCTT

GTGCCTTGCTCGCTCCGGTTGTACGCTTACACTGCTGGGCATTTAGTACATGAGTTCCCATGATAACCTCCTAACTAGTCCCCGACAACCACCTCATGTG

GTCAATAAATGGACTGGGAGCGTTTTAGCTGCCACTAACTC
Translation
 - UNI27213 - MSEARRDSTSSLQRKKPPWLKLDIPAAVPPAAEEPSFLQ PLRRQAFLRSVSMPAETARVPSPHHEPRRLVLQRQTSITQTIRS S

RQVRFGRVHTLPLLRPRAARKAHPQRQSLSWSLLR RGTADWFGVSKDSDSTQKWQRKSIRHCSQRYGKLKPQVIRELDLPSQDNVSLTSTETPPPLYVG

PCQLGMQK LPLRFQPTPSASQT             
Transcript ENSMUST00000020524
Sequence
GGACGGGTCGGGCCGGCGCGCGGGCGGCGCAGGCAGGGACTAGGCGCGGGCGCCCTCCCGGCCCGCAGCGGCGGCAGCAGCCGGTGCAGACCCTTCTGAG

GACCCTACGGCG - UNI27213 - GCTTGTCTCACTGCGCCCGGAACCATGAGTGAAGCCAGGAGAGACAGTACTAGCAGCCTGCAACGCAAGAAACC

CCCATGGCTCAAGTTGGACATCCCAGCCGCGGTGCCCCCGGCAGCAGAGGAGCCCAGCTTCCTGCAG CCCCTGCGGCGACAGGCTTTCTTGCGGAGTGT

GAGTATGCCAGCTGAGACAGCCCGGGTCCCATCACCCCACCATGAGCCTCGCCGGCTGGTGCTGCAGCGTCAGACATCCATCACACAGACCATCCGCAG 

GGGGACAGCAGACTGGTTTGGAGTGAGCAAGGACAGTGACAGCACCCAGAAGTGGCAGCGCAAGAGCATCCGTCACTGCAGCCAGCGGTATGGGAAGCTA

AAGCCGCAGGTCATCCGGGAGCTGGACCTGCCCAGCCAGGACAATGTGTCCCTAACCAGCACCGAGACACCACCTCCCCTCTACGTGGGGCCATGCCAGC

TGGGCATGCAGAAG ATCATAGACCCTCTGGCCCGAGGCCGGGCCTTTCGCATGGCTGATGACACTGCTGATGGCCTGAGTGCCCCCCACACTCCCGTCA

CACCAGGTGCAGCCTCCCTCTGCTCTTTCTCCAGCTCCCGCTCAGGTTTCAACCGACTCCCTCGGCGTCGCAAACGTGAATCGGTGGCCAAGATGAGCTT

CCGGGCCGCTGCAGCATTGGTGAAG GGTCGGTCTATTAGGGATGGCACTTTACGAAGGGGACAGCGCCGAAGCTTTACCCCTGCCAGCTTTCTTGAGGA

AGACATGGTGGACTTCCCTGATGAGTTGGATACATCTTTCTTTGCTCGG GAAGGTGTCCTCCACGAGGAGATGTCCACGTACCCAGATGAGGTGTTTGA

GTCCCCATCAGAGGCAGCGCTCAAGGACTGGGAGAAAGCCCCGGATCAGGCCGACCTCACGGGTGGGGCCCTGGACCGCAGTGAGCTTGAGAGAAGCCAC

TTGATGTT GCCCCTGGAACGAGGCTGGAGAAAGCAGAAGGAAGGCGGCCCTCTAGCCCCGCAGCCCAAGGTGCGGCTTCGCCAGGAGGTGGTCAGTGCG

GCGGGACCCAGGAGGGGTCAGCGTATCGCTGTGCCAGTGCGCAAACTCTTCGCTCGGGAAAAGCGGCCTTATGGTCTGGGGATGGTGGGACGGCTCACCA

ACCGCACGTACCGGAAACGCATCGACAGCTATGTCAAGCGGCAGATCGAGGACATGGATGATCACAG GCCCTTCTTCACTTACTGGCTCACCTTTGTGC

ACTCACTGGTCACCATTCTGGCTGTGTGCATCTATGGCATAGCGCCCGTGGGCTTCTCGCAGCATGAGACGGTGGACTCG GTACTTCGGAAGCGGGGTG

TCTATGAGAATGTCAAATACGTCCAGCAGGAGAACTTCTGGATTGGCCCCAGCTCG GAGGCCCTCATTCACTTGGGTGCCAAGTTCTCACCCTGCATGC

GTCAGGACCCACAGGTGCACAGCTTCATCCTGGCTGCCCGGGAGCGTGAAAAGCACTCGGCTTGCTGTGTACGCAATGATCGGTCTGGGTGTGTGCAGAC

TTCCAAGGAGGAGTGCTCG TCCACGTTGGCGGTGTGGGTGAAGTGGCCCGTTCATCCTAGTGCCCCAGACCTTGCAGGCAACAAGAGACAGTTTGGTTC

TGTCTGCCACCAGGACCCCAG GGTATGTGACGAGCCTTCCTCTGAGGATCCCCACGAGTGGCCAGAAGATATCACCAAGTGGCCG ATCTGCACCAAAA

GCAGCGCGGGGAACCACACTAACCACCCTCACATGGATTGTGTCATAACAGGCCGGCCTTGCTGCATCGGCACCAAGGGCAG GTGTGAGATCACCTCCC

GGGAGTACTGTGACTTCATGAGGGGCTACTTCCATGAGGAGGCCACACTCTGCTCTCAG GTGCACTGCATGGACGATGTCTGTGGCCTCCTGCCTTTCC

TCAATCCTGAGGTGCCTGACCAGTTCTACCGCCTGTGGCTGTCCCTCTTCCTGCACGCTGG GATCCTGCACTGCTTGGTGTCCGTCTGCTTCCAGATGA

CGGTCCTGCGGGACCTGGAGAAGCTGGCAGGCTGGCACCGCATAGCCATCATCTACCTGCTGAGTGGTATCACGGGCAATCTAGCCAGTGCCATCTTCCT

GCCATACCGGGCAGAG GTAGGTCCGGCCGGCTCCCAGTTTGGCATCCTGGCCTGCCTCTTTGTGGAGTTGTTCCAGAGCTGGCAGATCCTGGCCCGACC

CTGGCGTGCCTTCTTCAAGCTCCTGGCCGTGGTGCTCTTCCTCTTTGCCTTTGGGCTGCTGCCCTGGATCGACAACTTCGCCCACATCTCGGGCTTTGTC

AGCGGCCTCTTCCTTTCCTTTGCCTTCCTGCCTTACATCAGCTTTGGCAAGTTCGACCTGTACCGCAAGCGCTGCCAGATCATCATCTTCCAGGTCGTCT

TCCTGGGCCTGCTGGCCGGCCTGGTGGTCCTCTTCTACTTCTACCCGGTGCGCTGTGAATGGTGCGAGTTCCTCACCTGCATCCCTTTCACGGACAAGTT

CTGTGAAAAGTACGAGCTGGACGCTCAGCTCCACTGAACCAGCCGTGGACTCCCCAGGCCAGCCCGGCCTCCCAGGGCTGAACAGATGGGTGCTTCCTGG

ACACTGACCTCTTGTGCCTTGCTCGCTCCGGTTGTACGCTTACACTGCTGGGCATTTAGTACATGAGTTCCCATGATAACCTCCTAACTAGTCCCCGACA

ACCACCTCATGTGGTCAATAAATGGACTGGGAGCGTTTTAGCTGCCACTAACTC
Translation
 - UNI27213 - MSEARRDSTSSLQRKKPPWLKLDIPAAVPPAAEEPSFLQ PLRRQAFLRSVSMPAETARVPSPHHEPRRLVLQRQTSITQTIRR R

GTADWFGVSKDSDSTQKWQRKSIRHCSQRYGKLKPQVIRELDLPSQDNVSLTSTETPPPLYVGPCQLGMQK IIDPLARGRAFRMADDTADGLSAPHTPV

TPGAASLCSFSSSRSGFNRLPRRRKRESVAKMSFRAAAALVK GRSIRDGTLRRGQRRSFTPASFLEEDMVDFPDELDTSFFAR EGVLHEEMSTYPDEV

FESPSEAALKDWEKAPDQADLTGGALDRSELERSHLML LPLERGWRKQKEGGPLAPQPKVRLRQEVVSAAGPRRGQRIAVPVRKLFAREKRPYGLGMVG

RLTNRTYRKRIDSYVKRQIEDMDDHR RPFFTYWLTFVHSLVTILAVCIYGIAPVGFSQHETVDS VLRKRGVYENVKYVQQENFWIGPSS EALIHLGA

KFSPCMRQDPQVHSFILAAREREKHSACCVRNDRSGCVQTSKEECS STLAVWVKWPVHPSAPDLAGNKRQFGSVCHQDPR RVCDEPSSEDPHEWPEDI

TKWP ICTKSSAGNHTNHPHMDCVITGRPCCIGTKGR RCEITSREYCDFMRGYFHEEATLCSQ VHCMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAG 

GILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGITGNLASAIFLPYRAE VGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFAFGL

LPWIDNFAHISGFVSGLFLSFAFLPYISFGKFDLYRKRCQIIIFQVVFLGLLAGLVVLFYFYPVRCEWCEFLTCIPFTDKFCEKYELDAQLH

For any suggestions or comments, please send an email to unitrap@crg.es