Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020308 (Gtrgeo22)
Chromosomal location
Chr 10: 79132155 - 79138871 (+)
Description
gene trap ROSA b-geo 22 Gene [Source:MGI Symbol;Acc:MGI:106618]
RefSeq_dna
NM_148934 
RefSeq_peptide
NP_683736.1 
UniGene
Mm.22623 
MGI
MGI:106618 
Uniprot/SWISSPROT
Q99MS8 
Uniprot/SPTREMBL
B2RRP1 
Human Ortholog
ENSG00000141933 (C19orf20)
Omim not available
UniTrap UNI14420
Vector Insertion
Chr 10: 79132529 - 79138144
Public Clones (sanger) E028F02 (ggtc) P115F01 (ggtc) D146E09 (ggtc) E139A09 (ggtc)
D106D04 (ggtc) D184D10 (ggtc) 5SE305H12 (ggtc) E139H05 (ggtc) E130A06 (ggtc)
D008H08 (ggtc) P138D11 (ggtc) D184C10 (ggtc) E139C02 (ggtc) D130A06 (ggtc)
FHCRC-GT-S10-2G1 (fhcrc) FHCRC-GT-ROSA22 (fhcrc) FHCRC-GT-S13-7H1 (fhcrc)
IST14251E5 (tigm) IST14628B3 (tigm) IST11729F9 (tigm) IST14394B11 (tigm)
IST14312D11 (tigm) IST14054A9 (tigm) IST14584F8 (tigm) IST12417E12 (tigm)
IST14168B6 (tigm)
Private Clones OST471317 (lexicon) OST469299 (lexicon) OST463989 (lexicon) OST462179 (lexicon)
OST461741 (lexicon) OST457233 (lexicon) OST444817 (lexicon) OST440693 (lexicon)
OST436895 (lexicon) OST436518 (lexicon) OST433248 (lexicon) OST431912 (lexicon)
OST431708 (lexicon) OST419761 (lexicon) OST413080 (lexicon) OST405345 (lexicon)
OST405002 (lexicon) OST397351 (lexicon) OST382387 (lexicon) OST379211 (lexicon)
OST377545 (lexicon) OST373398 (lexicon) OST344655 (lexicon) OST335356 (lexicon)
OST329821 (lexicon) OST323261 (lexicon) OST301832 (lexicon) OST297460 (lexicon)
OST291280 (lexicon) OST287131 (lexicon) OST284697 (lexicon) OST284058 (lexicon)
OST283643 (lexicon) OST282001 (lexicon) OST279656 (lexicon) OST277069 (lexicon)
OST276038 (lexicon) OST272817 (lexicon) OST269468 (lexicon) OST268900 (lexicon)
OST268876 (lexicon) OST267262 (lexicon) OST263032 (lexicon) OST258375 (lexicon)
OST253227 (lexicon) OST253099 (lexicon) OST251445 (lexicon) OST250696 (lexicon)
OST250617 (lexicon) OST239922 (lexicon) OST234734 (lexicon) OST214819 (lexicon)
OST214745 (lexicon) OST208676 (lexicon) OST207084 (lexicon) OST206487 (lexicon)
OST205511 (lexicon) OST202914 (lexicon) OST202894 (lexicon) OST202377 (lexicon)
OST202226 (lexicon) OST198099 (lexicon) OST189695 (lexicon) OST182624 (lexicon)
OST180523 (lexicon) OST176783 (lexicon) OST176319 (lexicon) OST174144 (lexicon)
OST165579 (lexicon) OST153495 (lexicon) OST146366 (lexicon) OST145217 (lexicon)
OST140653 (lexicon) OST138808 (lexicon) OST138712 (lexicon) OST137461 (lexicon)
OST130898 (lexicon) OST110716 (lexicon) OST104941 (lexicon) OST99875 (lexicon)
OST90123 (lexicon) OST83235 (lexicon) OST81377 (lexicon) OST79933 (lexicon)
OST79597 (lexicon) OST69061 (lexicon) OST66273 (lexicon) OST57840 (lexicon)
OST54081 (lexicon) OST50697 (lexicon) OST48258 (lexicon) OST29707 (lexicon)
OST6205 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020552
Sequence
ATGGCGGCGCTTCCGGTCCCGCTGCCCCCAACAAAGATGGCGGCAGTGGAGAAACGGCGGCCGGCAGTAGCACCAGCGGCCAATTTCCCGGACAGTGGCC

GGACGTCGGTGTCTCAGGCGGCGGCGGCCGCTGAGAGCGAGGAGGACTTCCTACGGCAGCTCGGCGTGACGGAGATGCTGCGCGCAGCCCTCCTAAAGGT

GCTGGAGATCCGGCCCGAGGAGCCCATCGCCTTCTTGGCGCACTACTTCGAGAACATGGGTCTACGCTCGCCGACCAACGGAGGCGCCGGGGAGCCCCCG

GGCCAGCTCCTCCTGCAGCAACAGCGCCTGGGCCGCGCGCTGTGGCACCTTCGCCTGGCTCACCACTCGCAGAG - UNI14420 - GACCGCCTTCAA

CAACAACGTGAGCGTGGCCTACGAGTGTCTGAGTGCCAGCGGCCGCAAGAAGAAACCGGGGCTGGATGGGCGCACGTACAGCGAGCTGCTGAAGCGTGTT

TGCAGGGACGGCGGGGCGCCTGAGGAGGTGGTGGCGCCACTGCTTCGCAAGATCCAGTGCCGGGACCATGAGGCTGTGCCTCTGGGCATCTTCAGAACCG

GCATGCTGTCCTGCTTTGTGCTGCTGGAATTCGTGGCACGCGCCGGCGCCCTCTTCCAGCTGCTGGAGGACCCTGGTCAAGCGGTGGCCGATCGGCGTGT

GGGCCAGGCCGTGCTGGACACACTGGAGGGTGCGCTGAGCGCAGGAGACATGGCAACAGCACCCACGCACTACCTGGAGGCCGGTTCGCGCTTGGGCCCT

GACAACCTGGCGCGTGCCCTGGACAGGGCAGCAAGCGGGCGGCGACCCAGTGTGCCCATGGCCCGCGAGGAGTTCCTGGAGAAGGCTGCAGCCCTCTTCA

TTGCCAAGGTCAAGCCAGTGGGCTAAGACCACGATGCACCCACATCCCGCCACCTGCCCAGGACTTGGGACCTGCAAACTGATGTCCCGGCATTCTGCAC

AGGGTCATCACCCAGGAAGGGGTACCCGCTTGGACTTTGCAGGACCAGCACCTGCAGCTCAATCCCCTCTGTACTGGCCTGCCTACCCCACTCACAGAAA

TAAAATCTAAAACGA
Translation
MAALPVPLPPTKMAAVEKRRPAVAPAANFPDSGRTSVSQAAAAAESEEDFLRQLGVTEMLRAALLKVLEIRPEEPIAFLAHYFENMGLRSPTNGGAGEPP

GQLLLQQQRLGRALWHLRLAHHSQR - UNI14420 - RTAFNNNVSVAYECLSASGRKKKPGLDGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDH

EAVPLGIFRTGMLSCFVLLEFVARAGALFQLLEDPGQAVADRRVGQAVLDTLEGALSAGDMATAPTHYLEAGSRLGPDNLARALDRAASGRRPSVPMARE

EFLEKAAALFIAKVKPVG

For any suggestions or comments, please send an email to unitrap@crg.es